KEGG   Lactobacillus rhamnosus GG: LGG_02681Help
Entry
LGG_02681         CDS       T00987                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
lrh  Lactobacillus rhamnosus GG
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lrh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LGG_02681
Enzymes [BR:lrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     LGG_02681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2742922..2743704
Genome map
AA seq 260 aa AA seqDB search
MEMMFQAERTDLAHTVQVMFDRKDTNVAGGNMSIKVFDENEHPYILITPTFMSETYYAEL
HPAQILVVDAITGQKIDGVGDVTREINMHEKAYATHPGIRCVYHSHAEESMFWATAGLDM
PNVTEATRELGRIRVLPFAPATSMALANIVHDALLEIGDKAMENVFLLDSHGIVITSSDL
HIAVRIMETLEWNARIAYQQAIFIKLGLLDDFHSCGGNYKDPYKEVPPIAVPSTPIKSKQ
VPLPSNPTRPVSEMQLGEVE
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgatgtttcaggccgaacgtactgatcttgcccatacagtgcaagtgatgttc
gatcgtaaagataccaatgttgctggcggaaatatgtcaattaaagtttttgatgagaat
gagcatccctatatccttatcacacccacttttatgtctgaaacctattacgctgaattg
catcctgcacagatcctagttgttgatgcaatcaccggtcagaaaattgatggtgtcggc
gatgtaacccgagaaattaatatgcatgaaaaggcttacgcaactcatccgggtattcgc
tgtgtttatcattcgcatgctgaagaatctatgttttgggcaactgccggactcgatatg
cccaatgtgaccgaagcaaccagagaactcggacgtataagggttctcccctttgcacca
gcaacttcaatggcattggctaatatcgtacatgatgctctgcttgaaattggtgacaag
gctatggagaatgtctttttacttgatagtcatggtattgtgattacgagttctgacttg
catattgccgttagaatcatggaaacacttgaatggaatgctagaattgcctatcaacaa
gcaattttcattaaattaggcttgcttgacgattttcactcttgtggcggcaattacaaa
gatccttacaaagaggttccgccaattgcggtccctagtactccgattaagtcaaaacaa
gtacctttgccttccaatccaacaagacctgtcagcgaaatgcagttaggtgaagtagag
taa

DBGET integrated database retrieval system