KEGG   Lactobacillus rhamnosus Lc 705: LC705_00328Help
Entry
LC705_00328       CDS       T00990                                 

Gene name
bgaC
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
lrl  Lactobacillus rhamnosus Lc 705
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:lrl00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331215..332996
Genome map
AA seq 593 aa AA seqDB search
MTTFSIDHEFMLDGKPFKILSGAIHYFRVHPSDWYHSLYNLKALGFNTVETYVPWNLHEY
REGEFDFSGILDIERFLKTAEDLGLYAIVRPSPYICAEWEFGGFPAWLLTKKMRLRTDDP
AYLAAIDRYYTALMPHLVDHQVTHGGNVIMMQVENEYGSYGEDQDYLAAVAKLMQQHGVD
VPLFTSDGPWPATLNAGSMIDAGILATGNFGSAADKNFDRLAAFHQEHGRDWPLMCMEFW
DGWFNRWGEPIIRRDPDETAEDLRAVIKRGSVNLYMFHGGTNFGFMNGTSARKDHDLPQV
TSYDYDAPLNEQGNPTPKYFAIQKMIHEELPEVQQAKPLVKPTMAPASHPLTAKVSLFAV
LDQLAKPIAASYPQTQEFLGQYTGYTLYRTQPLISGTDKGTPAKLRVIDARDRVQAYLDQ
KWLATQYQEAIGDDILLPEVEGHHQLDLLVENMSRVNYGSKIEAITQFKGIRTGVMVDLH
FIKGYQQYPLDLNRASRLTFTEGWQPATPAFYKYTFDLTAPQDTYLDCHGFGKGVMLVNG
VNVGRFWEKGPTLSLYVPAGLLHAGKNDVIVFETEGRYAESLKMADHPIFKEP
NT seq 1782 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaccttttcgatcgatcatgaatttatgttggatgggaagccgttcaagatccta
tctggtgccattcattattttcgggtgcatccgagtgactggtatcacagcctgtataac
cttaaagctttagggtttaacacggtggaaacctatgtgccgtggaacttgcatgagtat
cgtgaaggcgagtttgattttagcggcatcctcgatattgaacgttttctcaaaactgcc
gaagatctcggcttgtatgcgattgtgcggccgtctccttatatctgtgcagagtgggag
tttggcggatttccggcatggctgttgacgaagaagatgcgtctgcgtaccgatgatcca
gcttatttggcggcaattgaccgttactataccgcattgatgccgcatttagttgatcat
caagttacccacggcggcaatgtgatcatgatgcaggtggaaaacgagtacggttcttat
ggtgaggatcaggattacttggcggcggttgcgaaactgatgcagcaacacggagttgat
gtgccactgttcacttcagatgggccgtggccagccaccttaaacgccgggagtatgatt
gatgccggcattctggcaacgggcaacttcggctcggctgccgataagaatttcgatcgg
ttagccgcttttcatcaggaacacggtcgcgactggccattgatgtgcatggaattctgg
gatggctggtttaaccgctggggtgagccgattatccgccgcgatcctgatgaaaccgcg
gaagatctgcgcgccgtcattaagcgcggcagtgtgaatctctacatgtttcatggtggg
acaaactttggcttcatgaacgggacgtctgcgcgtaaagaccatgacctgcctcaggta
acgtcttacgattacgatgccccgctaaatgaacaaggcaatccaacgccaaagtacttt
gccattcaaaaaatgatccatgaagagcttccagaagttcagcaagccaagccgctggtc
aaacccacgatggcgccagcttcacacccgttaacggctaaagtttccttgttcgcagtc
ttggatcagttagccaaaccgatcgccgcttcttatccgcagacgcaagaatttctgggc
caatataccggctataccttgtatcgtacgcagccgctcattagtggcactgacaaagga
acaccggccaagttgcgggtgatcgatgcccgtgatcgggtgcaagcttatttggatcaa
aaatggctagcaacccaataccaagaagcaattggtgatgatatcttgttgcctgaagtt
gagggacatcatcaacttgatttactggtagaaaacatgagtcgggtgaattacggatcc
aagattgaggcgatcacgcagttcaaagggattcgaaccggtgtcatggttgatctgcac
ttcatcaagggctatcagcaatacccgctggacttgaatcgcgcttctcggcttaccttt
acggaaggctggcagcccgcgaccccagcgttttacaagtacacgtttgatttgaccgcc
ccgcaagatacctatcttgattgtcatggattcggtaaaggagtgatgctggttaatggt
gtaaatgtcggcaggttttgggagaaaggccccacgttgtcactttatgtaccggcagga
ctcctgcacgccgggaaaaatgacgtcattgtgtttgaaaccgaaggccgctacgccgaa
agcttgaagatggctgaccacccgatatttaaggaaccatga

DBGET integrated database retrieval system