KEGG   Lactobacillus salivarius CECT 5713: HN6_00717Help
Entry
HN6_00717         CDS       T01962                                 

Gene name
pfkA
Definition
6-phosphofructokinase (Phosphofructokinase) (Phosphohexokinase) (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lsi  Lactobacillus salivarius CECT 5713
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lsi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HN6_00717 (pfkA)
   01230 Biosynthesis of amino acids
    HN6_00717 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HN6_00717 (pfkA)
   00030 Pentose phosphate pathway
    HN6_00717 (pfkA)
   00051 Fructose and mannose metabolism
    HN6_00717 (pfkA)
   00052 Galactose metabolism
    HN6_00717 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    HN6_00717 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    HN6_00717 (pfkA)
Enzymes [BR:lsi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     HN6_00717 (pfkA)
Protein phosphatases and associated proteins [BR:lsi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     HN6_00717 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
889329..890291
Genome map
AA seq 320 aa AA seqDB search
MKRIGILTSGGDAAGMNAAVRAIARSAMNAGLEAYGINYGYKGLVEGNIFKMESTKLDEI
INRGGTILYSARFPEFAETETQLKGIEQLKKFGIEALVVIGGDGSYHGAEKLTMHGYNSI
GVPGTIDNDIPGTDFTIGFDTAANVAMEALDRINDTATSHQRVFVVEVMGRGAGDIALWS
GIATGADAIVIPEREYDIEAIANKISENRKNGKDHGLIVLAEGVMGAAEFKEKLDQYGDF
DSRAITLGHIQRGGNPTVKDRVLATRLGDYAIRLLLEGKGGLAIGIHDNQLVATDIIDTL
ENHKHQTDVSLQDLNDRVRF
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattggtattttaactagtggtggcgatgcagctggtatgaatgcagctgta
cgtgcgattgctcgttctgcaatgaatgcaggtcttgaagcttacggtatcaactacgga
tataaaggacttgtagaaggtaacatctttaagatggaatctacaaaacttgatgaaatt
atcaatcgtggtggtactatcttatattctgcacgtttcccagaatttgcagaaacagaa
acacaattgaaaggtatcgaacaattaaagaaatttggtattgaagcattggttgttatc
ggtggcgatggttcataccatggcgcagaaaaattaactatgcacggatacaattcaatt
ggtgtaccaggaactattgataatgatattccaggtacagactttacaattggtttcgat
actgctgctaatgttgcaatggaagcattagatcgtatcaacgatactgcaacttcacac
caacgtgtattcgttgttgaagttatgggtcgtggcgcaggtgatattgcattatggtct
ggtattgctactggtgcagatgcaattgttattcctgaacgtgaatacgatattgaagct
atcgcaaataaaatttccgaaaaccgtaaaaacggtaaagatcatggcttaattgtttta
gcagaaggcgtaatgggcgctgctgaattcaaagaaaagcttgatcaatacggtgatttt
gatagtcgtgctattactttgggacatatccaacgtggtggtaacccaactgttaaagat
cgtgttttagctacaagacttggtgattatgctattcgcttattacttgaaggtaagggt
ggtttagctattggtattcatgataatcaattggttgcaactgatatcattgatacactt
gaaaatcacaaacatcaaacagatgtatcattacaagatttgaatgatcgtgttcgtttc
taa

DBGET integrated database retrieval system