KEGG   Lactobacillus salivarius UCC118: LSL_1498Help
Entry
LSL_1498          CDS       T00337                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsl  Lactobacillus salivarius UCC118
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LSL_1498 (gpmA)
   01230 Biosynthesis of amino acids
    LSL_1498 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSL_1498 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    LSL_1498 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LSL_1498 (gpmA)
Enzymes [BR:lsl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LSL_1498 (gpmA)
Exosome [BR:lsl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LSL_1498 (gpmA)
  Exosomal proteins of melanoma cells
   LSL_1498 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1553862..1554548)
Genome map
AA seq 228 aa AA seqDB search
MPKLVFIRHGQSEWNLKNLFTGWEDVNLSEKGVEEAKEAGRKLKEAGIEFDQAYTSVLTR
AIKTLHFALEESGQLWIPEMKTWRLNERHYGALQGKNKAAAAEKYGDEQVHIWRRSYDVL
PPLLSADDEGSAANDRRYADLDPRIIPGGENLKVTLERVIPFWEDHIAPDLLAGKNVIVA
AHGNSLRALTKYIEQISDEDIMNVEMATGQPVVYDLDDKLNIVNKEKL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttatccgtcacggacaaagtgaatggaacttaaagaaccttttc
acaggttgggaagacgttaacttgagtgaaaaaggtgttgaagaagctaaggaagcaggt
cgtaagttaaaagaagctggtatcgaatttgaccaagcttacacatctgttttaactcgt
gctatcaagactttacactttgctttggaagaatctggccaattatggattccagaaatg
aagacatggcgtttaaacgagcgtcactacggtgcattacaaggtaagaacaaagcagca
gctgctgaaaagtatggtgacgaacaagttcacatctggcgtcgttcttacgatgtatta
cctccattattgagtgcagatgatgaaggctctgcagcaaacgatcgtcgttatgctgac
ttagacccacgcatcattcctggtggcgaaaacttgaaagtcactttggaacgtgtaatt
cctttctgggaagatcacattgcaccagacttattggctggtaagaacgtaatcgttgct
gcacacggtaactcattacgtgctttaactaagtacatcgaacaaatctctgatgaagac
atcatgaacgttgaaatggcaacaggtcaaccagttgtttacgacttggatgacaagttg
aacattgtaaacaaagaaaagctttaa

DBGET integrated database retrieval system