KEGG   Lysinibacillus sphaericus: Bsph_0633Help
Entry
Bsph_0633         CDS       T00656                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_0633
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bsph_0633
Enzymes [BR:lsp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bsph_0633
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
650631..651914
Genome map
AA seq 427 aa AA seqDB search
MSTRQERIQTLEKQWAENPRWAGIERTYSAEEVVKLQGTVVIEQTLARKGATRLWNSLHE
EPFINALGALTGNQAVQQVKAGLKAIYLSGWQVAADANLSGQMYPDQSLYPANSVPAVVK
RINQALQRADQIDHAEGRVDQFDWFAPIVADAEAGFGGPLNVFELVKGMVEAGAAGVHLE
DQLASEKKCGHLGGKVLLPTQNAVRNLVAARLAADVMGVDTILIARTDADAADMVTSDID
PRDAEFITGERTPEGFFRTKAGIKQAIARGLAYAPYADLIWCETSKPSLEEAREFAEAIH
AEFPGKMLAYNCSPSFNWKANLSEEEIAEYQRELGKLGYKFQFVTLAGFHALNHSMFELA
HDYKDNGMAAYSKLQQAEFASESKGYTATRHQREVGTGYFDEISQVISGGTSSTTAMAGS
TETEQFV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactcgtcaagaaagaatccaaactttagaaaaacaatgggctgaaaaccctcgc
tgggctggtattgaacgcacatattcggctgaagaggttgttaaactacaaggtactgta
gtaattgaacaaactttggcaagaaaaggtgccactcgactatggaattcattacatgag
gaaccgtttattaatgcactgggtgcattaacaggtaatcaggcagtacagcaagttaaa
gctggactcaaagctatctatctatcgggctggcaagtagctgcggatgcaaacctttcg
ggtcaaatgtatccagatcaatcactatacccagccaattctgtaccagcagtagttaaa
cgaataaatcaagcacttcaacgagcagatcaaattgatcatgctgaaggacgtgtcgat
caatttgactggtttgctccaattgtagcagatgcagaggcaggtttcggaggacctctt
aatgtatttgagcttgttaaaggcatggtggaagcaggggcagctggtgttcaccttgaa
gatcagttagcttcagagaagaaatgtggtcatctaggcggtaaagttttacttccaaca
caaaacgctgtacgtaatttagtagctgcgagattagcagctgacgttatgggtgttgat
acaattctaatcgctcgtacagatgctgatgctgcagatatggttacttcagatatcgac
ccacgtgatgcagagtttattactggtgaacgtactcctgaaggttttttccgtacaaag
gcaggcatcaaacaagcaattgctcgtggcttagcttacgcaccatacgctgatttaatt
tggtgtgaaacttctaaaccatcacttgaggaagctcgtgaatttgcagaagctattcat
gcggaattcccaggtaaaatgcttgcatacaactgctcaccttcatttaactggaaagca
aatctttcagaagaggaaattgcagagtatcagcgtgagcttggtaagctaggttataaa
ttccagtttgttactttagcaggattccatgcattaaaccactctatgtttgagttggca
catgattataaagataatggtatggctgcatattctaagctacagcaagctgagtttgct
tccgaatctaaaggctatacagcgacacgccatcaacgcgaggtaggtactggatacttt
gatgaaatttctcaagttatttcaggtggtacatcttcaacaacggcaatggctggatcg
acagaaactgaacagttcgtataa

DBGET integrated database retrieval system