KEGG   Lysinibacillus sphaericus: Bsph_4249Help
Entry
Bsph_4249         CDS       T00656                                 

Definition
lisophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bsph_4249
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bsph_4249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4128436..4129242)
Genome map
AA seq 268 aa AA seqDB search
MWKWEADGQAKAVIAILHGAYENHRWYAWLIEKLRLEGFHIVMGDLPNHGVNARFARVHD
EDFKLYNKYTRNLIENAFSYNLPTFVIGHGLGATLVLHTMQKKKYECAGIILTSPWLQLK
LLPGKLSNALTSLSALTANVKLTHDLTFEKLTRSVEGREEMKDDIPFMSVVSVKWYRELQ
QMMRNLVMLPKDEFPNMPMLIMTAEKDKITETRQMRNWLHQQELTEFQFKEWANCYHNLF
HEVEREEIFMYIRDFINNALRRIGYIIK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagctgatggacaagcaaaggctgtgattgctattcttcatggtgct
tatgaaaaccaccgttggtatgcatggctgatagaaaaattaagattggaaggcttccac
atagtcatgggagatttaccgaatcatggtgtcaatgcaagatttgcccgtgtccatgat
gaggacttcaaattgtacaataaatatacaagaaatttgattgagaatgcattttcatat
aatttaccaacctttgtaataggacatggactaggcgctactttagttcttcatacaatg
caaaagaaaaagtatgagtgtgcaggtattattttgacatcaccatggctgcaattgaag
ctattaccaggtaaattatcaaatgctttaacaagcctgagtgcattaacagcaaatgta
aaattgacacatgacctgacatttgaaaaattgacgcgtagcgtagagggtagagaagaa
atgaaggatgatataccatttatgtctgtagtttcggtgaaatggtatcgtgagcttcag
cagatgatgagaaatttagttatgctacctaaggacgaatttcctaatatgcctatgtta
attatgacagctgaaaaagataaaattacggaaactcgacaaatgcgtaattggcttcat
caacaagagttaacggaatttcaatttaaagaatgggcaaattgttatcacaatttattt
catgaagtagagcgtgaagagatttttatgtacattcgagattttatcaataatgctctt
agacgaattggatatataataaaatag

DBGET integrated database retrieval system