KEGG   Lysinibacillus sphaericus: Bsph_4249Help
Entry
Bsph_4249         CDS       T00656                                 

Definition
lisophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:lsp00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4128436..4129242)
Genome map
AA seq 268 aa AA seqDB search
MWKWEADGQAKAVIAILHGAYENHRWYAWLIEKLRLEGFHIVMGDLPNHGVNARFARVHD
EDFKLYNKYTRNLIENAFSYNLPTFVIGHGLGATLVLHTMQKKKYECAGIILTSPWLQLK
LLPGKLSNALTSLSALTANVKLTHDLTFEKLTRSVEGREEMKDDIPFMSVVSVKWYRELQ
QMMRNLVMLPKDEFPNMPMLIMTAEKDKITETRQMRNWLHQQELTEFQFKEWANCYHNLF
HEVEREEIFMYIRDFINNALRRIGYIIK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaatgggaagctgatggacaagcaaaggctgtgattgctattcttcatggtgct
tatgaaaaccaccgttggtatgcatggctgatagaaaaattaagattggaaggcttccac
atagtcatgggagatttaccgaatcatggtgtcaatgcaagatttgcccgtgtccatgat
gaggacttcaaattgtacaataaatatacaagaaatttgattgagaatgcattttcatat
aatttaccaacctttgtaataggacatggactaggcgctactttagttcttcatacaatg
caaaagaaaaagtatgagtgtgcaggtattattttgacatcaccatggctgcaattgaag
ctattaccaggtaaattatcaaatgctttaacaagcctgagtgcattaacagcaaatgta
aaattgacacatgacctgacatttgaaaaattgacgcgtagcgtagagggtagagaagaa
atgaaggatgatataccatttatgtctgtagtttcggtgaaatggtatcgtgagcttcag
cagatgatgagaaatttagttatgctacctaaggacgaatttcctaatatgcctatgtta
attatgacagctgaaaaagataaaattacggaaactcgacaaatgcgtaattggcttcat
caacaagagttaacggaatttcaatttaaagaatgggcaaattgttatcacaatttattt
catgaagtagagcgtgaagagatttttatgtacattcgagattttatcaataatgctctt
agacgaattggatatataataaaatag

DBGET integrated database retrieval system