KEGG   Mycobacterium abscessus ATCC 19977: MAB_0220cHelp
Entry
MAB_0220c         CDS       T00657                                 

Definition
(RefSeq) Putative phenylalanine aminotransferase
  KO
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MAB_0220c
   00350 Tyrosine metabolism
    MAB_0220c
   00360 Phenylalanine metabolism
    MAB_0220c
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MAB_0220c
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    MAB_0220c
Enzymes [BR:mab01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     MAB_0220c
Amino acid related enzymes [BR:mab01007]
 Aminotransferase (transaminase)
  Class II
   MAB_0220c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
complement(232161..233204)
Genome map
AA seq 347 aa AA seqDB search
MPARLRPELTELPAYTPGRNVPGAIKLASNETVQEPLPSVRAALAEAGSLINRYPDNGYA
ELRSHLAKHVDMPPEHIAVGCGSVSLCQQLVQITATVGDEVLFGWRSFETYPLVVRVAGA
TPVQVPLVDHTYDLAAMAAAVTDVTRLIFVCNPNNPTGTVVRPAELRRFVESVPPHILIA
IDEAYVEYVREDFTDSLALVREHPNVVVLRTFSKAYGLAGLRVGYAVGDPDVITTLGKVY
VPFSASSLAQAAAVASLGAAEELLARTNDVVTERARVTSALREAGYQVPPSQANFVWLPL
GERSTEFAQASAEARIIVRPFGTDGVRVTIGAPMENDAFLKFSRAWR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgcccgcacgacttcgccccgaactgaccgaactaccggcctacacaccgggccgaaac
gtccccggcgccatcaagctcgccagtaatgagaccgtgcaggagccgctgccgagcgtg
cgggccgccctcgccgaggcggggtcgctgatcaatcggtaccccgataatggctacgcc
gagctgcgctcgcacctggccaagcacgtcgacatgccgcccgagcacatcgcggtgggg
tgcgggtcggtgagcctatgccagcagctggtccagatcaccgcaacggtgggcgacgag
gtgctgttcggctggcggtcctttgagacctatccgttggtggtgcgggtcgcgggggcg
actccggtgcaggtaccgctggtcgaccacacctatgacctcgccgccatggcggccgcc
gtaaccgacgtcacccggctgatcttcgtctgcaaccccaacaacccgaccggcaccgtg
gtgcggcccgccgaactgcggcggttcgtcgagtcggtgccgccgcatatcctgatcgcg
atcgacgaggcctacgtcgagtacgtacgcgaggacttcaccgacagcctcgcactggtg
cgtgagcaccccaatgtcgttgtcttacgcaccttctcaaaggcatacggcctggcgggg
ctgcgagtcggctacgcggtcggcgatcccgatgtgatcaccacactgggcaaggtgtac
gtaccgttcagcgcgtcgagcctggcgcaagctgccgcggtggcttccctcggcgccgcc
gaagagctgctcgcgcgcaccaatgacgttgtcaccgaacgcgcccgggtgaccagtgcg
ctgcgggaagccggctatcaggtgccgccgtcgcaggcgaacttcgtgtggttgccgctg
ggcgagcgctccaccgaattcgcgcaagcctccgccgaggcccgaatcattgtgcgcccc
tttggaaccgatggcgtccgggtgaccatcggagcaccgatggaaaacgacgcgttcctg
aagttctcgcgcgcctggcgctag

DBGET integrated database retrieval system