KEGG   Mycobacterium abscessus ATCC 19977: MAB_4916cHelp
Entry
MAB_4916c         CDS       T00657                                 

Definition
(RefSeq) Putative dihydrolipoamide acyltransferase component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mab  Mycobacterium abscessus ATCC 19977
Pathway
mab00010  Glycolysis / Gluconeogenesis
mab00020  Citrate cycle (TCA cycle)
mab00620  Pyruvate metabolism
mab01100  Metabolic pathways
mab01110  Biosynthesis of secondary metabolites
mab01120  Microbial metabolism in diverse environments
mab01130  Biosynthesis of antibiotics
mab01200  Carbon metabolism
Module
mab_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mab00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAB_4916c
   00020 Citrate cycle (TCA cycle)
    MAB_4916c
   00620 Pyruvate metabolism
    MAB_4916c
Enzymes [BR:mab01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     MAB_4916c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N
Motif
Other DBs
NCBI-GeneID: 5967370
NCBI-ProteinID: YP_001705638
UniProt: A0A2C9XZ54
Position
complement(5023481..5024788)
Genome map
AA seq 435 aa AA seqDB search
MAVKQFLLPDLGEGLTEADLISWKVRVGDEVKLNQVLADVETAKAMVELPSPFEGTVVAL
QAAENSTVAVGAPLISIEVAGAEPDAPANLVGYGPSDSAGQTRRRRRSGAGAAALALVEQ
TTEPEPAVAAPAAQAESVPSRAAAKPSVRKLAAELGVALELINGTGIGGSITRQDVEAYT
RSLTARAPQGAPAEEEPVAGVAVQPGGETRIPIAGVRKHTAAAMVRSAFTAPHVTEFLTV
DMTSTMGLLAELKAKSPDLKLTPMTLVARMVLLALRSHPSLNSAWDEQAGEIIVKHYVNL
GIAAATERGLVVPNVKGADAMSLGELATAIAQLVSTARAGKTAPTDMSGGTFTLTNIGVF
GVDAGTPIINPGEAAILALGSVAKRPWVVNGELAVRDVTTLALSFDHRLVDGEQGSKFLA
DLGAMLTDPRMALVV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaacagtttctgcttccagacctcggagaaggacttaccgaggcggatctg
atttcctggaaggtgcgggtcggcgacgaggtaaagctcaaccaggtgctcgccgacgtg
gagaccgcgaaggcgatggtcgaattgccgtcgcccttcgagggcacggtggtggcccta
caggcagccgagaattcgactgttgcggtgggcgcgccgctcatctcgatcgaggtggcc
ggtgccgagcccgacgcgcccgccaatctcgtgggatacggcccgtcggattcggcgggc
cagacgcggcgccggcgacgctcgggagccggtgcggccgcacttgccctcgtagaacag
acaaccgagccagagcccgccgtcgcggcgccggcagcccaggcagagtcggtaccgtcg
cgcgcggcagctaagccgtccgtccgcaagcttgccgccgagctgggcgtggccctcgaa
ctgatcaacggaacaggtatcggcggcagtatcacgcgccaggatgtggaggcatacacc
cgtagcctcaccgctcgtgcgccgcagggtgcgcccgcagaggaggagccggtggccggt
gtcgcggtccagccgggtggtgagacacggattccgattgcgggagtgcgcaaacacacc
gccgccgccatggtgcgtagcgcgttcaccgcaccgcacgtcaccgagttcctcaccgtc
gacatgacctcgacgatggggctgctggccgaactgaaggcgaagtctcccgatctcaag
ctcaccccgatgacgttggttgcacggatggtgttgctggccctgcggtcgcatccctcg
ctgaactccgcctgggatgagcaggccggagagatcatcgtgaagcattacgtgaatctg
ggcatcgcggcagccacggagcgaggattggtggtgccgaatgtcaagggagccgacgcg
atgtcgctgggtgaattggctactgctatcgcacagttggtgtccaccgcacgcgccggg
aagaccgcgccgaccgatatgagtgggggcacattcaccctcaccaatatcggggtcttc
ggtgtcgacgccgggacaccgatcatcaacccgggggaggcggcgatcctggcactgggc
tctgtcgccaagcgtccctgggtggtgaacggcgagctggcggtgcgggacgtcaccaca
ctggcgttgtcgttcgaccaccgactggtggacggtgagcagggatcgaagtttctcgcc
gatctgggggcgatgctcaccgatccacgaatggcactggtggtgtag

DBGET integrated database retrieval system