KEGG   Marinobacter adhaerens: HP15_2853Help
Entry
HP15_2853         CDS       T01922                                 

Gene name
gtfA
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
mad  Marinobacter adhaerens
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mad00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2993679..2995121
Genome map
AA seq 480 aa AA seqDB search
MLLKNAVQLICYPDRIGNNLKDLYTVVDTHLSEAIGGLHILPFFPSNADGGFSPLTHKEV
DPKVGTWDDIEAFTAKYDLCVDLTVNHISDESPEFTDFIANGFDSEYADLFVHVDKFGEI
SPDDMAKIHIRKEKEPFREVTLSDGTKTRVWCTFTEQQIDLNYESDLAYQLMESYIGFLT
SKGVNLLRLDAFGYTTKRIGTSCFLVEPEVYQILDWVNQVALKHGAECLPEVHDHTSYQY
AISRRNMHPYGFALPPLLLYSLLDANSTYLKNWLRMCPRNMVTVLDTHDGICIPDVEGVL
PDEKIKVLIDNIDARSADPIMRRSAANIHSVGAIYQLTCTFYDALMQNDDAYIAARAIQF
FTPGIPQVYYVGLLAGCNDHELMEQSGELRDINRHYYTLEEVEQDIQKPVVQRLLSLMKF
RSNYPAFDGHFELNYSNNSSVAMAWRHGDYYCHLFVDLNFKTVKVTYTDVETGETRHLEC
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgttgctcaaaaatgcggtgcagctgatctgttatccggaccggatcggcaacaatctg
aaagacctttacaccgtggtggacacgcatctgtccgaagccatcggcgggctgcacatc
ctgccgttttttccctccaacgccgatggcggcttctcgccgctgacccacaaggaagtg
gacccgaaggtgggcacctgggacgacatcgaagcctttacggcaaagtacgatctgtgc
gtggatctgacggttaatcatatctcggacgaatcgccggagttcaccgacttcattgcc
aacggcttcgactcggaatacgccgatctgtttgtgcacgtggacaaattcggcgagatc
tcaccggacgacatggcgaagattcacatccgcaaggagaaggaacccttccgggaagtg
accctgtccgacggcaccaaaacccgagtgtggtgtaccttcaccgagcagcagatcgac
ctgaattacgaatccgacctggcctatcagctgatggaaagctacatcggatttctgacg
tcaaaaggggttaatctgctgcggctggacgccttcggatacaccaccaaacggatcggc
accagctgctttctggtggaaccggaggtgtatcagatcctcgattgggtcaaccaggtt
gccttgaaacacggggcggaatgcctgccggaagtacacgaccacaccagctaccagtac
gccatcagccggcgcaacatgcacccctacggctttgccctgccgccgctgctgctctat
tcactgctggacgccaacagcacctacctgaagaactggctgcgcatgtgcccgcgcaac
atggtcaccgtgctggatacccatgacggcatctgcattcccgatgtggaaggcgttttg
ccggatgagaaaatcaaagtactgatcgacaacatcgacgcccgcagcgcggaccccatc
atgcggcgctcagcggccaacattcacagcgtgggtgccatctatcagctcacctgcacc
ttttatgacgcgctgatgcaaaacgacgacgcctacatcgccgcccgggccatccagttt
ttcaccccgggcatcccacaggtttactacgtggggctactggccggctgtaacgatcac
gagctgatggaacaaagtggcgagttgcgagacatcaaccgccattactacaccctcgaa
gaagtggagcaggacatccagaaaccggtggtacaacgcctgctaagcctgatgaagttc
cgcagcaactacccggcctttgatgggcacttcgaactgaactattccaacaactcaagc
gtggccatggcctggcgccatggagactattactgccacctgtttgtagacctgaacttc
aaaaccgtgaaggtcacttacaccgatgtggaaacgggggaaacccgacacctggagtgc
tga

DBGET integrated database retrieval system