KEGG   Mycobacterium africanum: MAF_05190Help
Entry
MAF_05190         CDS       T01575                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
maf  Mycobacterium africanum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:maf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAF_05190 (hemB)
Enzymes [BR:maf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     MAF_05190 (hemB)
Exosome [BR:maf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAF_05190 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
601362..602351
Genome map
AA seq 329 aa AA seqDB search
MSMSSYPRQRPRRLRSTVAMRRLVAQTSLEPRHLVLPMFVADGIDEPRPITSMPGVVQHT
RDSLRRAAAAAVAAGVGGLMLFGVPRDQDKDGVGSAGIDPDGILNVALRDLAKDLGEATV
LMADTCLDEFTDHGHCGVLDDRGRVDNDATVARYVELAVAQAESGAHVVGPSGMMDGQVA
AIRDGLDAAGYIDVVILAYASKFASAFYGPFREAVSSSLSGDRRTYQQEPGNAAEALREI
ELDLDEGADIVMVKPAMGYLDVVAAAADVSPVPVAAYQVSGEYAMIRAAAANNWIDERAA
VLESLTGIRRAGADIVLTYWAVDAAGWLT
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgagttcctatccgcggcagcgaccgcgccggctccgctccaccgtcgcgatg
cgccgtctggttgcgcaaacctcgttggagccaaggcatttggtgctgccgatgttcgtt
gccgacggcattgacgagccgcggccgattacctccatgccgggcgtggtacagcacacc
cgggattcgctacgtagggccgcggcagccgcggtggccgccggcgtgggtgggctgatg
cttttcggcgtgccgcgcgaccaggacaaggacggtgtcggttcggcgggcatcgacccc
gacgggatcctcaacgtcgcccttcgcgatctggccaaggacctgggtgaggccacggtg
ttgatggccgacacctgtctggacgagttcaccgaccacgggcactgcggtgtgctcgat
gaccggggccgggtcgataacgacgccaccgtggcccgctatgtggaactggctgtggcg
caagcggaatcgggcgcccacgtggtcggacccagtgggatgatggatggccaggtagcc
gcgatccgggacggtttggacgccgccggctacatcgatgtggtgatcttggcctacgcc
tcgaagtttgcttcggcgttctacggcccgttccgcgaggcggtgagctctagcctgtcc
ggggatcggcgcacctaccagcaggagccgggcaacgccgccgaggcgctgcgtgagatc
gagctcgatctcgacgaaggcgccgacattgtgatggtcaaacccgcgatgggctacctc
gatgtggtggcggccgcggcggacgtctcgccggtcccggtggccgcctatcaggtctcg
ggagagtacgcgatgattcgtgcggcggcggccaataattggatcgatgagcgtgccgcg
gtgctagagtcgctgaccggtatccggcgtgccggcgccgacatcgtgctcacctactgg
gcggtagacgcggcgggctggcttacgtga

DBGET integrated database retrieval system