KEGG   Magnetospirillum magneticum: amb3958Help
Entry
amb3958           CDS       T00305                                 

Definition
(RefSeq) succinyl-CoA synthetase
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mag  Magnetospirillum magneticum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mag00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    amb3958
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    amb3958
   00640 Propanoate metabolism
    amb3958
   00660 C5-Branched dibasic acid metabolism
    amb3958
Enzymes [BR:mag01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     amb3958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4366824..4368020
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQGKQVLAKYGVAVLKGGVAYTPDEAVQVAKDLGGPVWVVKSQIHAGGRGAGRFK
NDPNGKGGVRVAKSVEEVKTNVDQMLGQVLITKQTGPAGKEVKRVYIEQGCDIKRELYLS
MLVDRATCRVTIVASTEGGMEIEEVAHNHPEKILKVAIDPVEGFQQYHGRQIAFGLGLEG
KQVNTCVKFVGALYKAFMDLDCSIVEINPLVVTGAGELIALDAKVNFDDNALFRHKDIEE
LRDESEEDPAELEAARHSLNYIKLDGQIGCMVNGAGLAMATMDIIKLYGAEPANFLDVGG
GATKERVTTAFKLILSDPNVEGILVNIFGGIMRCDVIAEGVVAAAREVSLNVPLVVRLEG
TNVELGKKIMAQSGLPIIAADNLADAAEKVVKAVKEAA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatattcatgagtatcagggcaagcaggtgctggccaagtacggcgtcgccgtgctc
aagggcggcgtcgcctacacccccgacgaggcggtgcaggttgccaaggacctgggcggc
ccggtgtgggtcgtgaagtcgcagatccacgctggtggccgcggcgccggccgcttcaag
aacgaccccaatggcaagggcggcgtccgcgtcgccaagtccgtggaagaggtcaagacc
aacgtcgaccagatgctgggtcaggttctgatcaccaagcagaccggcccggccggtaag
gaagtcaagcgcgtctacatcgagcagggctgcgacatcaagcgcgagctgtacctgtcc
atgctggtcgaccgcgccacctgccgcgtcaccatcgtcgcctccaccgagggcggcatg
gagatcgaggaagtggcccacaaccacccggaaaagatcctgaaggtcgccatcgatccg
gtcgagggcttccagcagtatcacggccgccagatcgccttcggtctcggcctcgagggc
aagcaggtcaacacctgcgtcaagttcgtcggcgcgctgtacaaggccttcatggacctg
gattgctccatcgtcgagatcaacccgctggtggtcaccggcgccggcgagctgatcgct
ctcgacgccaaggtgaacttcgacgacaacgcgctgttccgtcacaaggacatcgaagag
ctgcgtgacgagtccgaggaagacccggccgagctcgaagccgcccgccacagcctgaac
tacatcaagctggacggccagatcggctgcatggtcaacggtgccggcctcgccatggcc
accatggacatcatcaagctgtacggcgccgagccggccaacttcctcgatgtcggcggc
ggcgccaccaaggagcgcgtgaccaccgccttcaagctgatcctctcggatcccaacgtc
gaaggcatcctggtcaacatcttcggcggcatcatgcgttgcgacgtcatcgccgagggc
gttgtcgccgctgcccgcgaagtttcgctgaacgtcccgctggtcgttcgtctggaaggc
accaacgtcgagttgggcaagaagatcatggctcagtcgggcctgccgatcattgccgcc
gacaatcttgccgatgccgccgagaaggtggtgaaggccgtgaaggaggctgcataa

DBGET integrated database retrieval system