KEGG   Micavibrio aeruginosavorus ARL-13: MICA_266Help
Entry
MICA_266          CDS       T01630                                 

Definition
D(-)-3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:mai00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:mai00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(292270..293058)
Genome map
AA seq 262 aa AA seqDB search
MTSLAGKTALITGSTSGIGLGIAQAMAAAGANVVLNGLGDTAEIEKIRLGLEKDHGIRAL
YHGADMTKPEQIRDMCEKSIGVFGAIDILVNNAGIQHVSPIDEFPEDKWNAIIAINLNSA
FHTTKACLPGMKKKGWGRVINIASAHGLVASPFKSAYIAAKHGLVGMTKTIALETATDNI
TCNAICPGYVLTPLVQNQIKDQAKVHNLPESEVVEKIMLTPQPTKKFVEVEQLGALSVFL
CSDAASNITGTSLPVDGGWTAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctcgccggaaaaaccgccctgattaccggatcgaccagtggcatcggattg
ggcattgcacaggccatggccgccgccggggccaacgtggtgttgaacggactgggcgat
acggcggagattgaaaaaatccggctggggctggagaaggatcacggcatccgcgcactc
tatcacggggccgacatgaccaagccggagcagatccgcgacatgtgcgaaaaatccatc
ggtgtatttggcgcgattgatattctggtcaacaatgccggcatccaacatgtcagcccg
attgatgaattccccgaagataaatggaacgccatcatcgccatcaatttgaacagcgcg
ttccacacgaccaaagcctgcctgcccggcatgaagaaaaagggctggggccgcgtgatc
aacattgcctccgcccacggccttgtcgcatcaccgtttaaaagtgcttatatcgccgcc
aaacacgggctggtcggcatgacgaaaacgattgcgctggaaaccgcaacggacaacatc
acctgcaacgccatttgcccgggctatgtcctgacgccactggtgcaaaaccagatcaag
gatcaggccaaggtccacaacctgcccgaaagcgaagtggtcgagaaaatcatgctgacc
ccgcagccgacgaagaaatttgttgaggtggaacagttgggcgcgctgtccgtgttcctg
tgttccgatgccgcatccaacatcaccggcacatcattgcccgtcgatggcggatggacg
gcccgataa

DBGET integrated database retrieval system