KEGG   Micavibrio aeruginosavorus ARL-13: MICA_266Help
Entry
MICA_266          CDS       T01630                                 

Definition
D(-)-3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mai  Micavibrio aeruginosavorus ARL-13
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mai00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    MICA_266
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MICA_266
Enzymes [BR:mai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MICA_266
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(292270..293058)
Genome map
AA seq 262 aa AA seqDB search
MTSLAGKTALITGSTSGIGLGIAQAMAAAGANVVLNGLGDTAEIEKIRLGLEKDHGIRAL
YHGADMTKPEQIRDMCEKSIGVFGAIDILVNNAGIQHVSPIDEFPEDKWNAIIAINLNSA
FHTTKACLPGMKKKGWGRVINIASAHGLVASPFKSAYIAAKHGLVGMTKTIALETATDNI
TCNAICPGYVLTPLVQNQIKDQAKVHNLPESEVVEKIMLTPQPTKKFVEVEQLGALSVFL
CSDAASNITGTSLPVDGGWTAR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaccagcctcgccggaaaaaccgccctgattaccggatcgaccagtggcatcggattg
ggcattgcacaggccatggccgccgccggggccaacgtggtgttgaacggactgggcgat
acggcggagattgaaaaaatccggctggggctggagaaggatcacggcatccgcgcactc
tatcacggggccgacatgaccaagccggagcagatccgcgacatgtgcgaaaaatccatc
ggtgtatttggcgcgattgatattctggtcaacaatgccggcatccaacatgtcagcccg
attgatgaattccccgaagataaatggaacgccatcatcgccatcaatttgaacagcgcg
ttccacacgaccaaagcctgcctgcccggcatgaagaaaaagggctggggccgcgtgatc
aacattgcctccgcccacggccttgtcgcatcaccgtttaaaagtgcttatatcgccgcc
aaacacgggctggtcggcatgacgaaaacgattgcgctggaaaccgcaacggacaacatc
acctgcaacgccatttgcccgggctatgtcctgacgccactggtgcaaaaccagatcaag
gatcaggccaaggtccacaacctgcccgaaagcgaagtggtcgagaaaatcatgctgacc
ccgcagccgacgaagaaatttgttgaggtggaacagttgggcgcgctgtccgtgttcctg
tgttccgatgccgcatccaacatcaccggcacatcattgcccgtcgatggcggatggacg
gcccgataa

DBGET integrated database retrieval system