KEGG   Marinobacter hydrocarbonoclasticus VT8: Maqu_0155Help
Entry
Maqu_0155         CDS       T00454                                 

Definition
pyridoxamine 5'-phosphate oxidase (EC:1.4.3.5)
Orthology
K00275  
pyridoxamine 5'-phosphate oxidase [EC:1.4.3.5]
Organism
maq  Marinobacter hydrocarbonoclasticus VT8
Pathway
Vitamin B6 metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:maq00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Maqu_0155
Enzymes [BR:maq01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.5  pyridoxal 5'-phosphate synthase
     Maqu_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(185036..185671)
Genome map
AA seq 211 aa AA seqDB search
MDIGDMRRDFESEGLDREHLNEDPVQQFQTWFEDARTAGILEPNAMSLATTGADGMPDLR
TVLLKYFDSQGFVFYTNYGSRKAQELQENPRAALLFPWIGLNRQVRIQGAVEKVSKAESL
RYFSSRPRGSQIGAWVSEQSQVITSRGLLEQKVAEMKRKFSSGEIPLPSFWGGYRVVPER
IEFWQGRPSRLHDRFEYVREGDGWTIQRLQP
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggatatcggcgatatgcgtcgggatttcgaaagcgaaggactggatcgggaacacctg
aacgaggatccggtacagcagttccagacctggttcgaggatgccagaacggcgggcatt
ctggagcccaatgccatgtcactggccaccaccggtgccgacggcatgcccgatctcaga
accgtgctactgaagtatttcgacagccagggttttgtgttctacaccaactacggcagc
cgcaaggctcaggagctgcaggagaatccccgggcggcactgctgttcccgtggatcggc
ctgaaccggcaggtgcgtattcagggtgcggtcgaaaaggtcagcaaggcggaatccctg
cgctacttttcgtcccggccccggggcagccagattggcgcctgggtttcggagcagagc
caggtcattacgtcccgaggcctgctggagcaaaaagtcgcggagatgaagcgcaaattc
agttccggagaaattccgctccccagtttctggggtgggtaccgggtggttccggagcga
atcgaattctggcagggaaggccgagccggcttcacgatcggtttgagtacgtgagagaa
ggcgatggctggacaatccaacgactgcaaccctga

DBGET integrated database retrieval system