KEGG   Mahella australiensis: Mahau_1293Help
Entry
Mahau_1293        CDS       T01494                                 

Definition
(GenBank) Beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
mas  Mahella australiensis
Pathway
mas00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mahau_1293
Enzymes [BR:mas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Mahau_1293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 Cellulase Glyco_hydro_2_C DUF4434 CAP18_C
Motif
Other DBs
NCBI-ProteinID: AEE96487
UniProt: F3ZWP4
Position
1348512..1350545
Genome map
AA seq 677 aa AA seqDB search
MVNPKLPAFFYGGDYNPEQWPEAIWQEDMRLFKLANINVATVAVFSWALLEPSEGQYDFT
WLDKVMDMLYEKGMYACLATSTAAQPAWMSKKYPGILPVTIDGQKRKHGRRVNFCPNSLD
YRRASQALVRQLALRYKDHPALVAWHVGNEYGTYCYCENCAKAFRQWLKERYGSLEELNK
RWYTNFWGHTVYDWEEIVPPSHLSETFSRGYMEGTYFQGIAIDYNRFMSDSSLACYKGEY
DIIKEVTPDIPVTTNLMGTFKPLDYFSWAKHMDVISWDNYPSNKAVMSNIAMRHDLMRGL
KGGQPFMLMEQTPNQQNWQPYNGLKRPGVMRLWSYQAVAHGADTVMFFQLRQSRGACEKY
HGAVISHAGHENTRVFREVSQLGEELKKLGDKILDSRINARVAIIFDWENWWATEYSSGP
SIDLKYVPQVEKYYKAFYDMNIPVDMINEDADLSKYDIVIAPLMYMVKPGVNGRLEDFVK
NGGTFVTTFFSGLVDENDLVVMGGYPGQLRQLLGIWVEETDALFPDMKNSIIISKPFGNL
HGQYQCGLLCDIVHLEGAQALGAYGSDFYAGMPAITVNDFGGGKAYYVASDPEDAFIKEF
VRYICDQKSIKPIMDVPDNVEVTQRIKDNTVFTFILNHNEHAVMVELGPQVQHELLSDKY
LSGATVIPARGVFILES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatcctaaattgccggctttcttttatggtggcgattacaatccggaacaatgg
ccagaagcgatatggcaggaagatatgcgcttgtttaagctcgctaacattaatgttgca
acggtagcggtattcagttgggcgttattagagccatcggaaggtcaatacgattttaca
tggttggataaagtaatggatatgctgtatgaaaagggtatgtatgcttgtttagccacc
tctacggcagctcaacctgcttggatgtcaaaaaagtatccggggatattgccggtaact
atagatggacaaaaacgcaagcatggccgtcgtgttaatttttgccccaatagcctcgat
tataggcgagcatcacaggcgttggtacgtcagctagccctgcgttataaggatcacccg
gcacttgtggcatggcatgtaggcaatgagtacggcacctattgttactgtgagaattgt
gctaaggcatttcgtcaatggctgaaagaacgatatggttcattagaagaactgaataaa
cgttggtatactaacttctgggggcataccgtatatgattgggaggagatagtaccgcct
tctcatctgagtgagacatttagccgcggctatatggaaggtacatattttcaaggcata
gccatagattataatcgctttatgtctgatagcagcctggcttgctataaaggtgaatac
gatattataaaagaagtaacaccggatatacctgttacaaccaaccttatggggacgttt
aagccgttggattacttctcatgggctaagcatatggacgtaatatcgtgggataattat
ccgtccaataaggcggttatgagcaatatagccatgaggcatgatctgatgcgaggtttg
aaaggcggtcaaccgtttatgttgatggaacaaacacccaaccaacagaattggcaaccg
tataatggattaaaacgtccaggtgttatgcgcctttggagttatcaggctgtggcgcac
ggagcggacacagtgatgttttttcagctaaggcagtcccgcggcgcatgtgagaaatac
catggcgctgttatatcgcatgctggtcatgaaaatacacgtgtattccgtgaggtcagt
caactgggagaagagttaaaaaaactgggcgataaaatactggattcacgcatcaatgct
cgcgtagccataatatttgattgggaaaattggtgggcgacagagtattctagcggccca
agcatagatttaaaatatgtccctcaggttgagaaatattataaagcgttttatgatatg
aatataccggtggatatgataaatgaagatgctgatttatctaaatatgatatagtgata
gcccctcttatgtatatggttaaaccgggcgtaaatgggagattggaggattttgtaaag
aatggtggtacatttgttaccacgttcttcagtggattggtagatgaaaatgatctcgtg
gtaatgggaggctatccggggcagttgcggcagcttttgggcatatgggtggaagagacc
gacgccttatttccagatatgaaaaatagtataattataagcaaaccttttggcaatttg
cacgggcaatatcaatgcggtcttctatgcgatattgtgcatttggaaggtgcgcaggcg
ttgggtgcttatggcagcgatttctatgcaggtatgccagcaattacagtaaacgatttt
ggtgggggtaaggcttattatgtggcctctgatccggaagatgcttttataaaggaattt
gtgcgctatatatgtgaccaaaaatctataaagcctattatggatgtaccggataatgta
gaagttacccaacgtataaaagataacaccgtgtttacctttattctcaatcataacgaa
catgcggttatggttgaacttgggccgcaagtacagcatgagcttttaagcgataaatat
ttgagcggtgccacggtgataccggctcgcggcgtatttatattggaaagttaa

DBGET integrated database retrieval system