KEGG   Mahella australiensis: Mahau_1293Help
Entry
Mahau_1293        CDS       T01494                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mas  Mahella australiensis
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mas00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1348512..1350545
Genome map
AA seq 677 aa AA seqDB search
MVNPKLPAFFYGGDYNPEQWPEAIWQEDMRLFKLANINVATVAVFSWALLEPSEGQYDFT
WLDKVMDMLYEKGMYACLATSTAAQPAWMSKKYPGILPVTIDGQKRKHGRRVNFCPNSLD
YRRASQALVRQLALRYKDHPALVAWHVGNEYGTYCYCENCAKAFRQWLKERYGSLEELNK
RWYTNFWGHTVYDWEEIVPPSHLSETFSRGYMEGTYFQGIAIDYNRFMSDSSLACYKGEY
DIIKEVTPDIPVTTNLMGTFKPLDYFSWAKHMDVISWDNYPSNKAVMSNIAMRHDLMRGL
KGGQPFMLMEQTPNQQNWQPYNGLKRPGVMRLWSYQAVAHGADTVMFFQLRQSRGACEKY
HGAVISHAGHENTRVFREVSQLGEELKKLGDKILDSRINARVAIIFDWENWWATEYSSGP
SIDLKYVPQVEKYYKAFYDMNIPVDMINEDADLSKYDIVIAPLMYMVKPGVNGRLEDFVK
NGGTFVTTFFSGLVDENDLVVMGGYPGQLRQLLGIWVEETDALFPDMKNSIIISKPFGNL
HGQYQCGLLCDIVHLEGAQALGAYGSDFYAGMPAITVNDFGGGKAYYVASDPEDAFIKEF
VRYICDQKSIKPIMDVPDNVEVTQRIKDNTVFTFILNHNEHAVMVELGPQVQHELLSDKY
LSGATVIPARGVFILES
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatcctaaattgccggctttcttttatggtggcgattacaatccggaacaatgg
ccagaagcgatatggcaggaagatatgcgcttgtttaagctcgctaacattaatgttgca
acggtagcggtattcagttgggcgttattagagccatcggaaggtcaatacgattttaca
tggttggataaagtaatggatatgctgtatgaaaagggtatgtatgcttgtttagccacc
tctacggcagctcaacctgcttggatgtcaaaaaagtatccggggatattgccggtaact
atagatggacaaaaacgcaagcatggccgtcgtgttaatttttgccccaatagcctcgat
tataggcgagcatcacaggcgttggtacgtcagctagccctgcgttataaggatcacccg
gcacttgtggcatggcatgtaggcaatgagtacggcacctattgttactgtgagaattgt
gctaaggcatttcgtcaatggctgaaagaacgatatggttcattagaagaactgaataaa
cgttggtatactaacttctgggggcataccgtatatgattgggaggagatagtaccgcct
tctcatctgagtgagacatttagccgcggctatatggaaggtacatattttcaaggcata
gccatagattataatcgctttatgtctgatagcagcctggcttgctataaaggtgaatac
gatattataaaagaagtaacaccggatatacctgttacaaccaaccttatggggacgttt
aagccgttggattacttctcatgggctaagcatatggacgtaatatcgtgggataattat
ccgtccaataaggcggttatgagcaatatagccatgaggcatgatctgatgcgaggtttg
aaaggcggtcaaccgtttatgttgatggaacaaacacccaaccaacagaattggcaaccg
tataatggattaaaacgtccaggtgttatgcgcctttggagttatcaggctgtggcgcac
ggagcggacacagtgatgttttttcagctaaggcagtcccgcggcgcatgtgagaaatac
catggcgctgttatatcgcatgctggtcatgaaaatacacgtgtattccgtgaggtcagt
caactgggagaagagttaaaaaaactgggcgataaaatactggattcacgcatcaatgct
cgcgtagccataatatttgattgggaaaattggtgggcgacagagtattctagcggccca
agcatagatttaaaatatgtccctcaggttgagaaatattataaagcgttttatgatatg
aatataccggtggatatgataaatgaagatgctgatttatctaaatatgatatagtgata
gcccctcttatgtatatggttaaaccgggcgtaaatgggagattggaggattttgtaaag
aatggtggtacatttgttaccacgttcttcagtggattggtagatgaaaatgatctcgtg
gtaatgggaggctatccggggcagttgcggcagcttttgggcatatgggtggaagagacc
gacgccttatttccagatatgaaaaatagtataattataagcaaaccttttggcaatttg
cacgggcaatatcaatgcggtcttctatgcgatattgtgcatttggaaggtgcgcaggcg
ttgggtgcttatggcagcgatttctatgcaggtatgccagcaattacagtaaacgatttt
ggtgggggtaaggcttattatgtggcctctgatccggaagatgcttttataaaggaattt
gtgcgctatatatgtgaccaaaaatctataaagcctattatggatgtaccggataatgta
gaagttacccaacgtataaaagataacaccgtgtttacctttattctcaatcataacgaa
catgcggttatggttgaacttgggccgcaagtacagcatgagcttttaagcgataaatat
ttgagcggtgccacggtgataccggctcgcggcgtatttatattggaaagttaa

DBGET integrated database retrieval system