KEGG   Mycoplasma arthritidis: MARTH_orf852Help
Entry
MARTH_orf852      CDS       T00724                                 

Gene name
recD
Definition
exodeoxyribonuclease V, alpha subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mat  Mycoplasma arthritidis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MARTH_orf852 (recD)
Enzymes [BR:mat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MARTH_orf852 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
786169..788367
Genome map
AA seq 732 aa AA seqDB search
MEEFVKVTGVFKKAIYERANGYKVFSFAIAHQEHPKEPIKTNHFGTISVVFNKLDVEVDK
YYDLVLEYQEASRYPNSYNLISLNESEYWKLNYIVKFLQSPHFPGIGPITAKKIVDKFGF
DTIKILTDDSSLNFLEFGMKKEAFEQMQTYLRENKQAVEDQIFFLKLNLSPDFYEKVNQK
FLTLESFINTYRDNFYEFYFDQQGLKISDLAKINKFFHPEGHEFDKAMIIYQALENFFFD
SGNTKTQISTFYSYFFKNIERVTVEEFKNNLKPLIVANKVLLFDNKSSITTSKLREMEEY
IVERMHRVQNGRNSLRDIKFEDNQFDYDSLQIEAINSALNEKMVLITGSPGTGKTLITNR
IIEELLKYYPEDRMAIVTPTGRATININKLSSKKAVTIHSFLQWDPDKNIFKINESWPES
IECLIIDEFSMVSVDLFFNLLKGISTRTLAKIILVGDKNQLPSIGPGYLIHDFIEANIFK
TIELTKIYRQSENYEIIQDAIDINEGRAPSFLGKNSQFRETKKEELAKKITEEISELLKQ
GYSKRDIAILSPIYNYQTGIDYLNDSLAKFWKKLENSEQNQISKTRKICLDDKVLNTVND
PSKKVFNGEIGYVSKFTFDKENSNIITHVAVDFEDDEKTVVYTKSEFLKKTIPAYCTSVH
KYQGSECKVVLTVLFSEAKRLLSKKLIYTAITRSKRLSIVFGEKEALEFGVKNDNDSHRQ
TCIKELWKAITE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggaagagtttgttaaagtaaccggcgttttcaaaaaagccatttatgaacgagcaaat
ggatataaagttttttcatttgcgattgctcaccaagagcatcctaaggagccaatcaaa
accaatcattttggcactattagcgtcgttttcaacaaattagatgttgaggttgacaaa
tactacgacttagttcttgaataccaagaggctagccgttatcctaatagctacaatcta
atttcgcttaatgaaagcgaatattgaaaattaaactatatcgtgaagtttttgcaaagt
ccgcattttcctggcataggccctattactgctaaaaagattgtcgataagtttggcttt
gacacgattaaaattctcactgatgatagctcgctaaattttttagaatttggtatgaaa
aaagaagctttcgagcagatgcaaacttatcttagagaaaacaaacaagccgttgaagac
caaattttcttcttaaagttaaatttgtcacccgatttttatgaaaaagttaatcaaaag
tttttgacattagaaagttttattaacacttatcgcgataatttttatgaattttatttt
gatcaacaaggcctaaaaatctcagacttagcaaaaataaataagttttttcaccctgag
ggacacgaatttgataaggctatgattatttatcaagcattggaaaatttcttttttgat
agtggcaatactaaaactcaaatttcaaccttctatagctacttttttaaaaatatcgaa
agagtcaccgttgaagaatttaaaaacaacttgaagccattaatcgttgctaacaaagtt
cttttattcgacaacaagagttctattactacttctaagctgcgcgaaatggaagagtat
attgttgaaagaatgcaccgggttcagaatggtcgcaactcattaagagatattaaattt
gaagataaccaatttgattatgatagtttgcaaatcgaagcaatcaacagcgctcttaat
gaaaaaatggtcttaatcactggcagtcctggcactggtaaaactttaattactaatcga
attattgaagaattgctgaagtattatccagaagatcgtatggcaattgttactcccact
ggaagggcgacgattaatatcaataaactctcttcaaaaaaagctgttactattcatagc
tttttacaatgagatcctgataaaaatatttttaagattaatgaaagttgaccagagtca
attgaatgtttaattattgatgaattttcgatggtgagcgttgatttattttttaattta
ttaaagggcatttcaacacggacacttgcaaaaataattctggttggcgataaaaatcaa
cttccttctataggaccaggttatttgattcatgattttattgaagcaaatatatttaaa
acaattgaattaactaaaatttatcgtcaatcagaaaactatgaaattattcaagatgct
attgatataaacgaagggagagcgccttcatttttaggcaagaattcgcaatttagagaa
actaaaaaagaagagttggctaaaaaaattactgaagaaattagtgaattgttaaaacaa
ggttatagcaagcgcgacattgctattcttagcccaatttataactatcaaacagggatt
gattatttaaatgattcactagctaaattttgaaaaaaacttgaaaattctgaacaaaat
caaatttctaaaactagaaaaatttgccttgatgataaagtactaaatactgtaaatgat
ccttctaaaaaagttttcaatggtgaaattggctatgtttctaaatttacttttgataaa
gaaaattctaatatcatcacgcatgtcgcagttgattttgaagacgatgaaaaaaccgtt
gtctatactaagagtgaatttcttaaaaaaactatcccagcttattgcactagtgtgcat
aaatatcaaggtagcgaatgtaaagtggttttaacggttctttttagcgaagcaaaaagg
cttttaagtaagaaattaatttacacagccattacgcgctcaaaaagactaagcattgtt
ttcggcgaaaaagaagctcttgaattcggtgtaaaaaatgataacgactcacatcgacaa
acctgtattaaagaattgtgaaaggcaataacggagtaa

DBGET integrated database retrieval system