KEGG   Mycobacterium avium 104: MAV_3878Help
Entry
MAV_3878          CDS       T00433                                 

Definition
glycosyl hydrolase, family protein 57
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mav  Mycobacterium avium 104
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mav00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JCVI-CMR: 
UniProt: 
Position
4007588..4009192
Genome map
AA seq 534 aa AA seqDB search
MNSSHDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLRVLDTLAGEDRR
GLLTLGVTPVVNAQLDDPYCLDGMHHWLANWRLRAMEAASVRSAPRSKSAGYQACTPEAL
RALGIRESAEAERALDDFATRWRHGGSPLLRRLLDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAALRLGARKGRGPGGIWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTA
LGRPVGDTDVVAFGRDLQVSYRVWSPKSGYPGHPAYRDFHTYDHLTGLKPARVTGRNVPS
EGKAPYDPDRADHAVDLHVADFVDVVRNRLTSESERIGRPAHVVAAFDTELFGHWWYEGP
RWLARVLRALPEAGVRVGTLHDAIAGGFVGDPVDLPPSSWGSGKDWQVWAGDQVADLVQL
NSEVVDTALSTVDKALSQAGSQPAALDGPVPRDHVADQILRETLLTVSSDWPFMVSKDSA
ADYARYRAHLHAHATREIAGALASGRRDTAQRLADGWNRADGLFGALDARRLPR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcctcgcacgaccgggttcccggcctgttcaccctggttttgcacacccacctg
ccgtggctggcccaccacggccgctggccggtcggcgaggaatggctgtatcaatcctgg
gcggcggcctacctgccgctgctgagggtgctggacacgctggccggcgaagaccgccgg
ggactgctcacgctcggcgtcacaccggtggtcaacgcgcagctcgacgacccgtattgc
cttgacggcatgcatcattggctggccaactggcggctgcgcgcgatggaagctgccagt
gtgcgctcggcgccccggtccaagtcggccggataccaggcgtgcacaccggaagcgttg
cgcgccttgggtattcgcgaatcggccgaggcggaacgagccctggacgatttcgccacg
cggtggcggcacggcggcagcccgctgctgcgccggctgctggacgccggcacggtcgag
ttgctgggcggcccgctggcccacccgttccagccgctgctggcaccgcggctgcgtgag
ttcgcgctgcgcgaggggctggccgacgcggcgttgcggctcggggcgcgaaaaggccgg
ggccccggcgggatctgggcgcccgaatgcgcctacgcgcccggcctcgagcacgactac
gccgcggccggcgtcacccatttcatggtcgacggcccgtcgctgcacggcgacaccgcg
ctgggccggcccgtcggcgacaccgacgtggtggcgttcgggcgcgacctgcaggtcagc
taccgggtgtggtcaccgaagtccggctatcccggccacccggcgtatcgcgacttccac
acctacgaccacctcaccggtctcaagccggcccgggtgacgggccgcaacgtgccctcg
gagggcaaggcgccctacgatccggaccgcgccgaccacgcggtcgacctgcacgtcgcc
gacttcgtcgacgtggtgcgcaaccgcctgaccagcgagtcggagcggatcgggcgtccg
gcgcacgtggtggccgcgttcgacaccgagctgttcgggcactggtggtacgagggcccg
aggtggttggcgcgggtgctgcgcgccctgcccgaggccggggtccgggtgggcaccctg
cacgacgcgatcgccggcggcttcgtcggcgacccggtggacctgccgcccagctcctgg
gggtcgggcaaggactggcaggtgtgggccggtgaccaggtcgccgacctggtccagctc
aactccgaggtggtcgacaccgcgctgagcaccgtcgacaaggccctctcacaagccggg
tcgcagcccgccgcgctggacgggccggtcccccgcgaccacgtggcggaccagatcctg
cgcgagaccctgctcaccgtctccagcgactggccgttcatggtgagcaaggactcggcc
gccgattacgcccgctaccgcgcccacctgcacgcccacgccaccagggagatcgcgggc
gcgctggcgtccggccggcgcgacaccgcgcagcggctggccgacgggtggaaccgcgcc
gacgggctgttcggggcgctggatgcgcgcaggctgccgcgatga

DBGET integrated database retrieval system