KEGG   Methanosarcina barkeri: Mbar_A1249Help
Entry
Mbar_A1249        CDS       T00271                                 

Definition
L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mba  Methanosarcina barkeri
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mba00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1553576..1554145
Genome map
AA seq 189 aa AA seqDB search
MWQEIAKYGRKLVEHGLVESNFGNISLRAGDRMLITRTGAALDEITENNVVEVDVWDTSS
LDIIASSEAVVHREIYRQTSALAIIHAHAPYAVVESLLAGPEGRISPVDSEGQYFLGEIP
VVGGGIGSCELAGNLANALSRHRGAIVYSHGTFAIGRTLGDAYIATTQLEHSCKVKYLYE
RAKTERESK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaattgcaaaatatgggcgcaagctggttgaacacgggcttgtcgaatct
aactttggaaatatcagcctcagggctggcgacaggatgcttatcacccggacaggtgcc
gcacttgacgaaatcacagagaataatgttgttgaagttgacgtttgggacacttcttcc
ctggatataattgcgtcttccgaagctgtagtacacagagaaatttacaggcagacctca
gcacttgcaatcattcacgctcatgctccatatgcggttgttgagtctctgctcgcaggc
cccgagggacgaatttcacctgtagatagtgaaggacagtacttccttggggaaattccg
gtcgtcggaggaggaataggcagctgcgagcttgcaggaaatcttgcaaatgcgctctca
aggcatagaggcgctatagtttacagtcacggaacttttgcaatcgggagaacgcttgga
gacgcctatatagcgaccacgcagcttgagcattcctgcaaagttaagtacctgtacgag
cgtgcgaaaacagaaagggaaagtaaataa

DBGET integrated database retrieval system