KEGG   Methanosarcina barkeri: Mbar_A1249Help
Entry
Mbar_A1249        CDS       T00271                                 

Definition
L-fuculose-phosphate aldolase
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mba  Methanosarcina barkeri
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mba00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Mbar_A1249
Enzymes [BR:mba01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Mbar_A1249
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1553576..1554145
Genome map
AA seq 189 aa AA seqDB search
MWQEIAKYGRKLVEHGLVESNFGNISLRAGDRMLITRTGAALDEITENNVVEVDVWDTSS
LDIIASSEAVVHREIYRQTSALAIIHAHAPYAVVESLLAGPEGRISPVDSEGQYFLGEIP
VVGGGIGSCELAGNLANALSRHRGAIVYSHGTFAIGRTLGDAYIATTQLEHSCKVKYLYE
RAKTERESK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaggaaattgcaaaatatgggcgcaagctggttgaacacgggcttgtcgaatct
aactttggaaatatcagcctcagggctggcgacaggatgcttatcacccggacaggtgcc
gcacttgacgaaatcacagagaataatgttgttgaagttgacgtttgggacacttcttcc
ctggatataattgcgtcttccgaagctgtagtacacagagaaatttacaggcagacctca
gcacttgcaatcattcacgctcatgctccatatgcggttgttgagtctctgctcgcaggc
cccgagggacgaatttcacctgtagatagtgaaggacagtacttccttggggaaattccg
gtcgtcggaggaggaataggcagctgcgagcttgcaggaaatcttgcaaatgcgctctca
aggcatagaggcgctatagtttacagtcacggaacttttgcaatcgggagaacgcttgga
gacgcctatatagcgaccacgcagcttgagcattcctgcaaagttaagtacctgtacgag
cgtgcgaaaacagaaagggaaagtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system