KEGG   Methanoculleus bourgensis: BN140_1175Help
Entry
BN140_1175        CDS       T02189                                 

Definition
cellulase (EC:3.4.11.15)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mbg  Methanoculleus bourgensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BN140_1175
Enzymes [BR:mbg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BN140_1175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1209808..1210845)
Genome map
AA seq 345 aa AA seqDB search
MVKELLRKLSDAHGVSSREGNIRDIIRAELAGSVDEITEDVMGNLIATKRGDDFSIMLAA
HMDEIGLMVQYIDEKGFIRVVSIGGWFGPVLYCQRVILHGKKGPVMGVIGAKPPHVMKPE
DRKKEIKIEDMFIDVGATSASEVNDLGIEIGTPITIDREYTELAGNRVTGKALDNRVGVA
MLIRALQQAKSPHTIYGVFTVQEELGLKGAKVSAYSLNPNCAIATDVTIPGDHPGIEKKD
ASVEMGKGPVIELVSASGRGLMADLRVATWLRETAEKNDIPYQLEVGTGGNTDATIIHLE
RGGIPSIPFAIATRYIHSPVEVVDTGDLEAGIRLLVEALKSKPAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagagttactcaggaagttatcggacgctcacggcgtctcgagcagggaagga
aacatcagggatatcatcagggcagagcttgccggatcggtcgacgagatcaccgaggat
gtgatgggcaacctgatcgccaccaagcgcggtgacgacttttccatcatgctcgccgcc
cacatggacgagatcggcctgatggtccagtatatcgacgagaaggggttcatcagggtt
gtctccatcggcggatggtttgggccggtgctctactgccagcgggtgatcctgcacggg
aagaagggcccggttatgggggtcatcggtgcaaagcccccacacgtgatgaaaccggag
gaccgcaagaaggagatcaagatcgaggatatgttcatcgacgtgggtgccacctctgcc
tcggaggtaaacgacctcggtatcgagatcggcaccccgatcaccatcgaccgggagtac
acggaacttgccggcaaccgggtgaccgggaaggcgctcgacaaccgggtcggcgtcgca
atgctcatccgggccctgcagcaggcgaagtccccccacacgatatacggcgtcttcacg
gtccaggaggagctggggctgaagggggcgaaggtgagcgcttactccttaaaccccaac
tgtgcgatcgcaaccgacgtcaccatccccggcgaccacccggggatcgagaagaaggac
gcgagcgtggagatgggcaagggtccggtcatcgagctggtcagcgcgagcgggcgcggc
ctcatggccgacctgcgggtggccacgtggctccgggagaccgcagagaagaacgacatc
ccctatcagcttgaggtcgggaccggcgggaacaccgacgcgaccatcatccacctcgag
cggggcggcatcccgagcatcccgttcgcgatcgcaacccgctatatccactcccccgtc
gaggtggtcgataccggcgaccttgaggcagggatcaggctcctcgtcgaggcgctgaag
agcaagcccgcactctga

DBGET integrated database retrieval system