KEGG   Methanoculleus bourgensis: BN140_1175Help
Entry
BN140_1175        CDS       T02189                                 

Definition
(GenBank) cellulase (EC:3.4.11.15)
Organism
mbg  Methanoculleus bourgensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
complement(1209808..1210845)
Genome map
AA seq 345 aa AA seqDB search
MVKELLRKLSDAHGVSSREGNIRDIIRAELAGSVDEITEDVMGNLIATKRGDDFSIMLAA
HMDEIGLMVQYIDEKGFIRVVSIGGWFGPVLYCQRVILHGKKGPVMGVIGAKPPHVMKPE
DRKKEIKIEDMFIDVGATSASEVNDLGIEIGTPITIDREYTELAGNRVTGKALDNRVGVA
MLIRALQQAKSPHTIYGVFTVQEELGLKGAKVSAYSLNPNCAIATDVTIPGDHPGIEKKD
ASVEMGKGPVIELVSASGRGLMADLRVATWLRETAEKNDIPYQLEVGTGGNTDATIIHLE
RGGIPSIPFAIATRYIHSPVEVVDTGDLEAGIRLLVEALKSKPAL
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaagagttactcaggaagttatcggacgctcacggcgtctcgagcagggaagga
aacatcagggatatcatcagggcagagcttgccggatcggtcgacgagatcaccgaggat
gtgatgggcaacctgatcgccaccaagcgcggtgacgacttttccatcatgctcgccgcc
cacatggacgagatcggcctgatggtccagtatatcgacgagaaggggttcatcagggtt
gtctccatcggcggatggtttgggccggtgctctactgccagcgggtgatcctgcacggg
aagaagggcccggttatgggggtcatcggtgcaaagcccccacacgtgatgaaaccggag
gaccgcaagaaggagatcaagatcgaggatatgttcatcgacgtgggtgccacctctgcc
tcggaggtaaacgacctcggtatcgagatcggcaccccgatcaccatcgaccgggagtac
acggaacttgccggcaaccgggtgaccgggaaggcgctcgacaaccgggtcggcgtcgca
atgctcatccgggccctgcagcaggcgaagtccccccacacgatatacggcgtcttcacg
gtccaggaggagctggggctgaagggggcgaaggtgagcgcttactccttaaaccccaac
tgtgcgatcgcaaccgacgtcaccatccccggcgaccacccggggatcgagaagaaggac
gcgagcgtggagatgggcaagggtccggtcatcgagctggtcagcgcgagcgggcgcggc
ctcatggccgacctgcgggtggccacgtggctccgggagaccgcagagaagaacgacatc
ccctatcagcttgaggtcgggaccggcgggaacaccgacgcgaccatcatccacctcgag
cggggcggcatcccgagcatcccgttcgcgatcgcaacccgctatatccactcccccgtc
gaggtggtcgataccggcgaccttgaggcagggatcaggctcctcgtcgaggcgctgaag
agcaagcccgcactctga

DBGET integrated database retrieval system