KEGG   Methanoculleus bourgensis: BN140_2247Help
Entry
BN140_2247        CDS       T02189                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mbg  Methanoculleus bourgensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BN140_2247
   01230 Biosynthesis of amino acids
    BN140_2247
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2247
   00030 Pentose phosphate pathway
    BN140_2247
   00051 Fructose and mannose metabolism
    BN140_2247
   00052 Galactose metabolism
    BN140_2247
  Energy metabolism
   00680 Methane metabolism
    BN140_2247
Enzymes [BR:mbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN140_2247
Protein phosphatases and associated proteins [BR:mbg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     BN140_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2367092..2368126
Genome map
AA seq 344 aa AA seqDB search
MTTIGVLTGGGDCPGLNAVIRAVVRTGAKYGFDTIGIRDGWHGLIAGDVEPLTDYSVTGI
LPKGGTILGTSRTNPFKDEADVQRLRDNIKRFGIDALVAIGGEDTLGVANKLSTMGIPVV
GVPKTIDNDVAATDYTFGFDTAVSIVTEAIDRLHTTAESHHRIMVVEVMGRHAGWIATMA
GIAGGADQILIPEVPFDLDEVAGHLQARYEKGKKFSIVVVAEGAQPKGMEGAITQSARTD
EFGHVTLGGIGTFLRDELEKRLGMETRVTVLGHVQRGGSPTAHDRVLATRFGVAAVELIR
EKDFGKMVALRGNDIVAVPLEEAVANLKTVDMDLYKIASIFYGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgataggtgtcctgacaggaggaggagactgccccggactgaacgcggtgatc
cgggcggttgtgcggaccggggcgaagtatgggtttgacacgatcgggatcagggacgga
tggcacgggttgatcgccggagacgtcgaaccgctcaccgattactcggtgaccgggatc
ctcccgaagggggggacgatcctcgggacgtcgcggacgaaccccttcaaagacgaggct
gacgtccagcggttgcgcgacaacatcaagaggttcgggatcgacgcgctggtcgccatc
gggggcgaggataccctcggtgtcgcgaataaactctcaacaatgggtatcccggtggtt
ggggttccaaagaccatcgataacgacgtcgccgcgaccgactacaccttcggattcgac
accgctgtctcaatcgtcaccgaggcgatcgaccgccttcacacgacggcagagtcccat
caccgcatcatggtggtggaggtgatgggccggcatgccggctggatcgcgaccatggcc
gggatcgcgggtggggcagaccagatactcatcccagaggtcccgttcgacctcgacgag
gtcgccgggcacctccaggcgcgctacgagaaagggaagaagttcagcatcgtcgtggtc
gccgagggtgcccagccaaaggggatggaaggagcgataacccagtcggccaggactgac
gagttcgggcacgtgacgctcggcggtatcgggacgttcctgcgcgacgaacttgagaaa
aggctcgggatggagacgcgggtgacggtgctcgggcatgtccagcggggcggatccccg
acggcgcacgaccgggtgctcgcgaccaggttcggggtggcggcggtggaactcatcagg
gagaaggatttcgggaagatggtcgcgctccggggcaacgacatcgtcgcggtcccgctc
gaggaggcggtggcgaacctcaagaccgtggatatggacctctacaagatcgcaagcatc
ttttatgggggctaa

DBGET integrated database retrieval system