KEGG   Methanoculleus bourgensis: BN140_2247Help
Entry
BN140_2247        CDS       T02189                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mbg  Methanoculleus bourgensis
Pathway
mbg00010  Glycolysis / Gluconeogenesis
mbg00030  Pentose phosphate pathway
mbg00051  Fructose and mannose metabolism
mbg00052  Galactose metabolism
mbg00680  Methane metabolism
mbg01100  Metabolic pathways
mbg01110  Biosynthesis of secondary metabolites
mbg01120  Microbial metabolism in diverse environments
mbg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BN140_2247
   00030 Pentose phosphate pathway
    BN140_2247
   00051 Fructose and mannose metabolism
    BN140_2247
   00052 Galactose metabolism
    BN140_2247
  Energy metabolism
   00680 Methane metabolism
    BN140_2247
Enzymes [BR:mbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BN140_2247
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     BN140_2247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DUF128
Motif
Other DBs
NCBI-GeneID: 13354197
NCBI-ProteinID: CCJ37170
UniProt: I7L0Z7
Position
2367092..2368126
Genome map
AA seq 344 aa AA seqDB search
MTTIGVLTGGGDCPGLNAVIRAVVRTGAKYGFDTIGIRDGWHGLIAGDVEPLTDYSVTGI
LPKGGTILGTSRTNPFKDEADVQRLRDNIKRFGIDALVAIGGEDTLGVANKLSTMGIPVV
GVPKTIDNDVAATDYTFGFDTAVSIVTEAIDRLHTTAESHHRIMVVEVMGRHAGWIATMA
GIAGGADQILIPEVPFDLDEVAGHLQARYEKGKKFSIVVVAEGAQPKGMEGAITQSARTD
EFGHVTLGGIGTFLRDELEKRLGMETRVTVLGHVQRGGSPTAHDRVLATRFGVAAVELIR
EKDFGKMVALRGNDIVAVPLEEAVANLKTVDMDLYKIASIFYGG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgataggtgtcctgacaggaggaggagactgccccggactgaacgcggtgatc
cgggcggttgtgcggaccggggcgaagtatgggtttgacacgatcgggatcagggacgga
tggcacgggttgatcgccggagacgtcgaaccgctcaccgattactcggtgaccgggatc
ctcccgaagggggggacgatcctcgggacgtcgcggacgaaccccttcaaagacgaggct
gacgtccagcggttgcgcgacaacatcaagaggttcgggatcgacgcgctggtcgccatc
gggggcgaggataccctcggtgtcgcgaataaactctcaacaatgggtatcccggtggtt
ggggttccaaagaccatcgataacgacgtcgccgcgaccgactacaccttcggattcgac
accgctgtctcaatcgtcaccgaggcgatcgaccgccttcacacgacggcagagtcccat
caccgcatcatggtggtggaggtgatgggccggcatgccggctggatcgcgaccatggcc
gggatcgcgggtggggcagaccagatactcatcccagaggtcccgttcgacctcgacgag
gtcgccgggcacctccaggcgcgctacgagaaagggaagaagttcagcatcgtcgtggtc
gccgagggtgcccagccaaaggggatggaaggagcgataacccagtcggccaggactgac
gagttcgggcacgtgacgctcggcggtatcgggacgttcctgcgcgacgaacttgagaaa
aggctcgggatggagacgcgggtgacggtgctcgggcatgtccagcggggcggatccccg
acggcgcacgaccgggtgctcgcgaccaggttcggggtggcggcggtggaactcatcagg
gagaaggatttcgggaagatggtcgcgctccggggcaacgacatcgtcgcggtcccgctc
gaggaggcggtggcgaacctcaagaccgtggatatggacctctacaagatcgcaagcatc
ttttatgggggctaa

DBGET integrated database retrieval system