KEGG   Monosiga brevicollis: MONBRDRAFT_16206Help
Entry
MONBRDRAFT_16206  CDS       T01042                                 

Definition
hypothetical protein
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
mbr  Monosiga brevicollis
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    MONBRDRAFT_16206
Enzymes [BR:mbr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     MONBRDRAFT_16206
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 607 aa AA seqDB search
LSPLVRQVDFALDWMHLDAGERLYQQNDPSDVVYLLLSGRVRSVITRPDGSKAIMREYGR
HELVGELEVLTETPRATTIHAVRDAELAKIPAGLLHLVKHKHPHVATHLMRMLSERLLGL
VKGVELESTDPNLTTVALLPTSPTVPLSLFAERLRRALGLYGETLHLNAAIVKEQFGMHP
CTIRGSQEYSFVRWLASQEDRHSVVLYEADYELNDWTRRCIRQADCVLIVGVGHETPSVG
PAESELENVAAKAQKELVLLHRDDTFMPKRTADWLNARTWCSRHHHIRCDDDILPKEKTL
NRKRQPRPIGPSRFTLIERSDFGRLARHLSGHSIGLVLGGGGARGAAELGVIKQLEEAGI
PIDIVGGTSIGSLMAALYAEELNYADMKQRFDDFTTTMGSQVNMALDLTYPVVAMFSGRA
FNRVIEDLFGNRQIEDLWLPFFCVTTDITASKKKVHSYGSLWRYVRASMSLSGYLPPLCD
PEDGHMLLDGGYVDVLPIEVMRQHGATYMFAVDVSAKDLNDYENFGDEISGFWLLFQRLN
PFVSKPKIPHMEDIASKLAFIASDNYLNEVASTYCDLDTFFFFFFFFFCVVLMLMAHALV
FVARTSQ
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
ctctcgcctttggtgcgccaagtggattttgccctggattggatgcacttggacgctggc
gagcgcctctaccagcagaacgatccctccgatgtggtttatcttctcttgagcggtcgc
gtacgatcggtgattacgcgtccggatggcagtaaagccatcatgcgcgagtatggtcgc
catgagctcgtgggtgagcttgaggtattgaccgagacgccacgtgcaactaccattcat
gccgtgcgcgatgccgagctggcaaagatccccgcgggtttgctgcacctggtcaagcac
aaacatccgcatgtggccacacatctgatgcgcatgctctccgagcgcttgttgggactg
gtcaagggtgtagagctagagagcaccgaccccaatttgaccaccgtggccttgttgccc
acctcgcccaccgtgccattgtccttgtttgctgagcgactgcgtcgcgctttgggcctg
tatggtgaaaccctccacctcaacgctgccattgtcaaggaacaatttggcatgcatccc
tgcaccattcgtggctcgcaggaatattcctttgtccgatggctggcatcacaagaagat
cggcatagcgttgtgctatatgaggccgactacgagctgaacgactggacgcgtcgctgc
attcggcaagccgactgtgtgcttattgtcggcgtgggacatgaaaccccttccgtgggt
ccagccgaatcggagctggagaacgtggcggccaaggcacaaaaagagctggtcctcctg
caccgtgatgacacgttcatgccaaagcgtacggccgattggctgaacgcccgcacttgg
tgttcgcgccatcatcacatccgttgcgatgatgacatcttacccaaggaaaaaaccttg
aaccgcaagcgtcagccgcggcctattgggccgagccgcttcacgctcattgaacgcagc
gattttggacgccttgctcgtcatctctcgggtcattctatcggattggttcttggcggc
ggcggtgcacgtggcgcggcggagctgggcgtgataaagcaattggaagaagcaggtata
cccatcgacattgtcggcggcacctccatcggctcgcttatggctgcgctttatgcagaa
gaactgaactatgctgatatgaagcagcggttcgatgattttaccacaaccatgggttca
caggtgaacatggctttggatttgacctacccagtcgtggccatgttctcgggacgcgct
ttcaaccgggttattgaggatttgtttggcaaccgacaaatcgaagatctttggctgccc
tttttctgtgtgaccacagatatcacggccagcaagaaaaaggtacatagctacggttcg
ctatggcgctatgtgcgcgcttccatgtcgctgagcggatacctacctcctctctgcgat
ccggaggatggccacatgctccttgatggcggctatgtcgacgttttgcccattgaggtt
atgcgccagcacggcgccacttatatgtttgccgtggacgtctcagccaaggacctcaac
gattatgagaactttggtgatgagatcagtgggttttggctgctatttcagcgtctcaac
ccctttgtcagcaagcccaagatccctcacatggaagacattgcctccaagttggccttt
attgctagcgacaactatctcaacgaggttgcttcgacttactgcgaccttgatacgttt
tttttttttttttttttttttttttgtgtggttctgatgctcatggcacatgcgctggtt
ttcgtagctcgaacgtcacaatga

DBGET integrated database retrieval system