KEGG   Monosiga brevicollis: MONBRDRAFT_24180Help
Entry
MONBRDRAFT_24180  CDS       T01042                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mbr  Monosiga brevicollis
Pathway
mbr00010  Glycolysis / Gluconeogenesis
mbr00051  Fructose and mannose metabolism
mbr00562  Inositol phosphate metabolism
mbr01100  Metabolic pathways
mbr01110  Biosynthesis of secondary metabolites
mbr01130  Biosynthesis of antibiotics
mbr01200  Carbon metabolism
mbr01230  Biosynthesis of amino acids
Module
mbr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mbr_M00002  Glycolysis, core module involving three-carbon compounds
mbr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mbr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MONBRDRAFT_24180
   00051 Fructose and mannose metabolism
    MONBRDRAFT_24180
   00562 Inositol phosphate metabolism
    MONBRDRAFT_24180
Enzymes [BR:mbr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MONBRDRAFT_24180
Exosome [BR:mbr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MONBRDRAFT_24180
  Exosomal proteins of bladder cancer cells
   MONBRDRAFT_24180
  Exosomal proteins of melanoma cells
   MONBRDRAFT_24180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5889800
NCBI-ProteinID: XP_001744473
JGI: 24180
UniProt: A9UVM7
AA seq 248 aa AA seqDB search
MGRRFFVGGNWKLNGSRASIQELLEAWGKADLDKSVEVVISPPAVYADFLRANMPAEFGL
ALQNVYKEGSGAFTGENSADMALDVGADWVILGHSERRSIFGESNELIGEKTAYCLGKGI
KVIACVGEQLEEREAGNTQAVVETQLKAIAAKVSDWSKVVIAYEPVWAIGTGKTASPEQA
QEVHASIRAWLSKEVSATVAAETRIIYGGSVKPSNCAELGKQEDIDGFLVGGASLKPDFT
TIINAQKA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtcgtttctttgttggcggcaattggaagctgaatggctcccgcgccagcatc
caggagcttctcgaggcctggggcaaggctgacctcgataagtctgttgaggtggtcatc
tccccaccagccgtctacgccgactttttgcgtgccaacatgcccgcagagtttggcctg
gcgcttcaaaatgtctacaaggagggcagtggcgcctttaccggcgaaaacagcgccgac
atggccctggatgtgggtgccgactgggtcattctgggccactcggagcgccgtagcatt
tttggcgagtccaacgagctcattggtgagaagaccgcatactgcctcggcaagggcatc
aaggtgattgcttgcgtcggagagcaacttgaagagcgtgaagccggtaacacccaggcc
gttgtggaaacccagttgaaggccattgctgccaaggtctccgactggtccaaggtcgtg
atcgcctacgagcccgtctgggccatcggcactggcaagacagcctcaccggagcaggcc
caggaggtccatgccagcatccgggcctggctcagcaaggaggtcagcgccacggtcgct
gctgagacccgcatcatctacggaggctcggtcaagccaagcaactgcgccgagcttggc
aagcaggaggacattgacggttttttggtgggtggcgcttccctcaagcccgactttacc
accatcatcaatgcccagaaggcctag

DBGET integrated database retrieval system