KEGG   Macaca mulatta (rhesus monkey): 693377Help
Entry
693377            CDS       T01028                                 

Gene name
PPT1
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
mcc00062  Fatty acid elongation
mcc01100  Metabolic pathways
mcc01212  Fatty acid metabolism
mcc04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    693377 (PPT1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    693377 (PPT1)
Enzymes [BR:mcc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     693377 (PPT1)
Lipid biosynthesis proteins [BR:mcc01004]
 Fatty acid synthase
  Component type
   693377 (PPT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Glyco_hydro_98M
Motif
Other DBs
NCBI-GeneID: 693377
NCBI-ProteinID: NP_001248261
Ensembl: ENSMMUG00000009189
UniProt: A0A1D5QL55
Position
1
AA seq 306 aa AA seqDB search
MASPSCLWLLAVALLPWTCAARALHHLDPPAPLPLVIWHGMGDSCCNPLSMGAIKKMVEK
KIPGIYVLSLEIGKTLMEDVENSFFLNVNSQVTTVCQTLAKDPKLQQGYNAMGFSQGGQF
LRAVAQRCPSPPMINLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYSKVVQERL
VQAEYWHDPIKEDVYRNHSIFLADINQERGINESYKKNLMALKKFVMVKFLNDSIVDPVD
SEWFGFYRSGQAKETIPLQETSLYTQDRLGLKEMDNAGQLVFLATEGDHLQLSEEWFYAH
IIPFLG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcccagctgcctgtggctcttggctgtcgccctcctgccatggacctgcgct
gcccgggcgttgcatcatctggacccgccggcgccgctgccgttggtgatctggcatggg
atgggagacagctgttgcaatcccttaagcatgggtgctattaaaaaaatggttgagaag
aaaatacctggaatttacgtcttatctttagagattgggaagaccttgatggaggacgtg
gaaaacagcttcttcttgaatgtcaattcccaagtaacaacagtgtgtcagacacttgct
aaggatcctaaattgcagcaaggctacaatgctatgggattctcccagggaggccaattt
ctgagggcagtggctcagagatgcccttcacctcccatgatcaatctgatctcagttggg
ggacaacatcaaggtgtttttggactccctcgatgcccaggagagagctctcacatctgt
gactttatcagaaaaacactgaatgctggcgcgtactccaaagttgttcaggaacgcctc
gtgcaagctgaatactggcatgaccccataaaagaggatgtatatcgcaaccacagcatc
ttcttggcagatataaatcaggagcggggtatcaatgagtcctacaagaaaaacctgatg
gccctgaagaagtttgtgatggtgaaattcctcaatgattccattgtggaccctgtagat
tcggagtggtttggattttacagaagtggccaagccaaggaaaccattcccttacaggag
acctccctgtacacacaggaccgcctggggctaaaagaaatggacaatgcaggacagcta
gtgtttctggctacagaaggggaccatcttcagttgtctgaagaatggttttatgcccac
attataccattccttggatga

DBGET integrated database retrieval system