KEGG   Macaca mulatta (rhesus monkey): 695163Help
Entry
695163            CDS       T01028                                 

Gene name
DYRK3
Definition
(RefSeq) dual specificity tyrosine phosphorylation regulated kinase 3
  KO
K18669  dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Brite
Enzymes [BR:mcc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     695163 (DYRK3)
Protein kinases [BR:mcc01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   695163 (DYRK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Choline_kinase RIO1 FTA2 YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 695163
NCBI-ProteinID: XP_001086002
Ensembl: ENSMMUG00000023566
UniProt: F7FZF8
Position
1
AA seq 568 aa AA seqDB search
MKWKEKLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNITTEKFIRDHTQHFLDG
GEMKVEQLFQEFGNRKSNTVQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVP
LTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHV
PRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHL
KKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSIL
QSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEI
ILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAK
YFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLK
RCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRIVNPASAFQGLGSKLPPVVG
IANKLKANLMSETNGSIPLCSVLPKLIS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaagtggaaagagaagttgggggatggtgtctatgataccttcatgatgatagatgaa
accaaatgtcccccctgttcaaatgtgctctgcaatccttctgaaccacctccacccaga
agactaaatatcaccactgagaagtttataagggatcatactcagcactttttggatgga
ggtgagatgaaggtagaacagctgtttcaagaatttggcaacagaaaatccaatactgtt
cagtcagatggcatcagtgactctgaaaaatgctctcctactgtttctcagggtaaaagt
tcagattgcttgaatacagtaaaatccaacagttcatccaaggcacccaaagtggtgcct
ctgactccagaacaagccctgaagcaatataaacaccacctcactgcctatgagaagctg
gaaataattaattatccagaaatttactttgtaggtccaaatgccaaaaaaagacatgga
gttattggtggtcccaataatggggggtatgatgatgcagatggggcctacattcatgta
cctcgagaccatctagcttatcgatatgaggtgctgaaaattattggcaaggggagtttt
gggcaggtggccagggtctatgatcacaaactgcggcagtacgtggccctgaaaatggtg
cgcaatgagaagcgctttcatcgtcaagcagctgaggagatccggattttggagcatctt
aaaaaacaggataaaactggtagtatgaacgttatccacatgctggaaagtttcacattc
cggaaccatgtttgcatggcctttgaattgctgagcatagacctttatgagctgattaaa
aaaaacaagtttcagggttttagcgtccagttggtacgcaagtttgcccagtccatcttg
caatccttggatgccctccacaaaaataagattattcactgcgatctgaagccagaaaac
attctcctgaaacaccacgggcgcagctcaaccaaggtcattgactttgggtccagctgt
ttcgagtaccagaagctctacacatatatccagtctcggttctacagagctccagaaatc
atcttaggaagccgttacagcacaccgattgacatatggagttttggctgcatccttgca
gaacttttaacaggacagcctctcttccctggagaggatgaaggagaccagttggcctgc
atgatggagcttctagggatgccaccaccaaaacttctggagcaatccaaacgtgccaag
tactttattaattccaagggcataccccgctactgctctgtgactactcaggcagatggg
agggttgtgcttgtggggggtcgctcacgtaggggtaaaaagcggggtcccccgggcagc
aaagactggggaacagcactgaaagggtgtgatgactacttgtttatagagtttttgaaa
aggtgtcttcactgggacccctctgcccgcctgaccccagctcaagcattaagacaccct
tggattagcaagtctgtccccagacctctcaccaccatagacaaggtgtcagggaaacgg
atagttaatcctgcaagtgctttccagggattgggttctaagctgcctccagttgttgga
atagctaataagcttaaagctaacttaatgtcagaaaccaatggtagtatacccctatgc
agtgtgttgccaaaactgattagctag

DBGET integrated database retrieval system