KEGG   Macaca mulatta (rhesus monkey): 711061Help
Entry
711061            CDS       T01028                                 

Gene name
ADH1C
Definition
alcohol dehydrogenase 1C (class I), gamma polypeptide
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mcc  Macaca mulatta (rhesus monkey)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mcc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    711061 (ADH1C)
  Lipid metabolism
   00071 Fatty acid degradation
    711061 (ADH1C)
  Amino acid metabolism
   00350 Tyrosine metabolism
    711061 (ADH1C)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    711061 (ADH1C)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    711061 (ADH1C)
   00982 Drug metabolism - cytochrome P450
    711061 (ADH1C)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    711061 (ADH1C)
Enzymes [BR:mcc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     711061 (ADH1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
5
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWEVKKPFSIEEVEVAPPKAHEVRIKMVAVGICRSDDHVVSGTLVT
PLPAILGHEAAGIVESVGEGVTTVKPGDKVIPLFTPQCGKCRVCKNPESNYCFKNDLSNP
RGTMQDGTRRFTCRGKPIHHFLGISTFSQYTVVDENAVAKIDASSPLEKVCLIGCGFSTG
YGSAVKVAKVTPGSTCAVFGLGGVGLSAVMGCKAAGAARIIAVDINKDKFAKAKELGATE
CINPQDYKKPIQEVLKEMTDGGVDFSFEVIGRLDTMMASLLCCHEACGTSVIVGVPPDSQ
NLSINPVLLLTGRTWKGAIFGGFKSKESVPKLVSDFMAKKFSLDALITNVLPFEKINEGF
DLLRSGKSIRTILMF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagcactgcaggaaaagtaatcaaatgcaaagcagctgtgctatgggaggtaaagaaa
cccttttccattgaggaggtggaggttgcacctcctaaggctcatgaagttcgcattaag
atggtggccgtaggaatctgtcgttcagatgaccacgtggttagtggtaccctagtgacc
cctcttcctgcgattttaggccacgaggcagctggcatcgtggagagtgttggagaaggg
gtgactacagtcaaaccaggtgataaagtcatcccactctttactcctcagtgtggaaaa
tgcagagtttgtaaaaacccagaaagcaactactgcttcaaaaatgatctgagcaatcct
cgggggaccatgcaggatggcaccaggaggttcacctgcagggggaagcccatccaccac
ttcctcggcatcagcaccttctcccagtacacggtggtggatgagaatgcagtggccaaa
attgatgcatcttcacccctggagaaagtctgcctcattggctgtggattttcgactggc
tatgggtctgcagtcaaagttgccaaggtcaccccaggctctacctgtgctgtgtttggc
ctgggaggggtcggcctatctgctgttatgggctgtaaagcagctggagcagccagaata
attgcggtggatatcaacaaggacaaatttgcaaaggccaaagagttgggtgccactgaa
tgcatcaaccctcaagactacaagaaacccattcaggaggtgctaaaggaaatgactgat
ggaggtgtggatttttcatttgaagtcatcggtcggcttgacaccatgatggcttccctg
ttatgttgtcatgaggcatgtggcacaagtgtcatcgtaggggtacctcctgattcccag
aacctctcaataaaccctgtgctgctactgaccggacgcacctggaaaggagctattttt
ggaggctttaagagtaaagaatctgtccccaagcttgtgtctgactttatggctaagaag
ttttcactggatgcattaataacaaatgtcttaccttttgaaaaaataaatgaaggattt
gacttgcttcgctctggaaagagtatccgtaccatcctgatgttttga

DBGET integrated database retrieval system