KEGG   Macaca mulatta (rhesus monkey): 712985Help
Entry
712985            CDS       T01028                                 

Gene name
BCKDK
Definition
branched chain ketoacid dehydrogenase kinase (EC:2.7.11.4)
Orthology
K00905  
[3-methyl-2-oxobutanoate dehydrogenase (acetyl-transferring)] kinase [EC:2.7.11.4]
Organism
mcc  Macaca mulatta (rhesus monkey)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
20
AA seq 412 aa AA seqDB search
MILASVLGSGPRGGPPLRPLLGPTLALRARSTSATDTHHVEMARERSKTVTSFYNQSAID
AAAEKPSVRLTPTMMLYSGRSQDGSHLLKSARYLQQELPVRIAHRIKGFRCLPFIIGCNP
TILHVHELYIRAFQKLTDFPPIKDQADDTQYCQLVRQLLDDHKDVVTLLAEGLRESRKHI
EDEMLVRYFLDKTLTSRLGIRMLATHHLALHEDKPDFVGIICTRLSPKKIIEKWVDFARR
LCEHKYGNAPRVRINGHVAARFPFIPMPLDYILPELLKNAMRATMESHLDTPYNVPDVVI
TIANNDVDLIIRISDRGGGIAHKDLDRVMDYHFTTAEASTQDPRISPLFGHLDMHSGAQS
GPMHGFGFGLPTSRAYAEYLGGSLQLQSLQGIGTDVYLRLRHIDGREESFRI
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcgtcggtactggggagcggcccccggggcgggcctccgctccggcccctc
ctggggcccacactcgcgctccgggcccgctcgacgtcagccactgacacacaccacgtg
gagatggctcgggagcgctccaagaccgtaacctccttttacaaccagtctgccatcgac
gcggcagcggagaagccctcagtccgcctcacgcccaccatgatgctctactccggccgc
tctcaggacggcagccaccttctgaaaagtgctcgttacctgcaacaagaacttccagtg
aggattgctcaccgcatcaagggcttccgctgccttcctttcatcattggctgcaacccc
accatactgcacgtgcacgagctatacatccgtgccttccagaaactgacagacttccct
ccgattaaggaccaggcggacgacacccagtactgccagctggtgcgacagctgctggat
gaccacaaggatgtggtgaccctcttggcagagggcctgcgtgagagccggaagcacata
gaggatgaaatgctcgtacgctacttcttggacaagacgctgacttcgaggcttggaatc
cgcatgttggccacgcatcacctggcgctgcatgaggacaagcctgactttgtcggcatc
atctgtactcgtctctcaccaaagaagattattgagaagtgggtggactttgccagacgc
ctgtgtgagcacaagtatggcaatgcaccccgtgtccgcatcaatggccacgtggccgcc
cggtttcccttcatccctatgccactggactacatcctgccggagctgctcaagaacgcc
atgagagccacaatggagagtcacctagacactccctacaatgtcccagatgtggtcatc
accatcgccaacaatgatgtcgatctgatcatcaggatctcagaccgtggtggaggaatc
gctcacaaagatctggaccgggtcatggactaccacttcactaccgctgaggccagcaca
caggacccccggatcagccccctctttggccacctggacatgcacagtggcgcccagtca
ggacccatgcacggctttggcttcgggttgcccacgtcacgggcctacgcggagtacctc
ggtgggtctctgcagctgcagtccctgcagggcattggcacggacgtctacctgcggctc
cgccacatcgatggccgggaggaaagcttccggatctga

DBGET integrated database retrieval system