KEGG   Methylobacterium extorquens CM4: Mchl_4602Help
Entry
Mchl_4602         CDS       T00809                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mch  Methylobacterium extorquens CM4
Brite
Enzymes [BR:mch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Mchl_4602
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_23 Methyltransf_11 Methyltransf_31 CMAS MTS GCD14 Methyltransf_12
Motif
Other DBs
NCBI-ProteinID: ACK85376
UniProt: B7KPY3
Position
complement(4879794..4880492)
Genome map
AA seq 232 aa AA seqDB search
MPPEAGEPDERADRLSAGLAEATGNAAFVLALRERGVRDTAVLRAMEQVPRERFAPPALR
PHARRDIALPLACGQTMTAPSVVAQMLGALDLAPGQRVLEVGTGTGYVTALLVRLGAAHV
RSLERYEGLARAARAHLGRDLSDVTVETNDGLAPEVVRGGSYDRILVNGSLAALPPHLPA
ALKSGGRLVVGHWTGRGSRLVTLTRDSAAAYARTEGAALRLGPLTPGRALAP
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgccgcctgaggccggagagcccgacgaacgggctgatcggctgtccgcggggctggcg
gaggcgaccggcaacgccgccttcgtgctggccctgcgcgagcggggcgtgcgcgacacc
gccgttctgcgggcgatggaacaggtcccgcgcgagcgcttcgcgccgccggccctgcgc
ccccatgcgcggcgcgacatcgccctgccgctcgcctgcggccagaccatgaccgcgccg
agcgtcgtcgcgcagatgctcggcgccctcgacctcgcccccggccagcgcgtgctggag
gtcggcaccggcacgggctacgtcaccgctctgctggtccggctcggggccgcccatgtg
cgcagcctggagcgctacgaggggctcgcccgcgcggcgcgggcgcatctggggcgcgac
ctttccgacgtcaccgtcgagaccaatgacgggctcgcgcccgaagtcgttcggggcgga
agctacgaccgcatcctcgtcaacggcagcctcgccgcgctgccgccgcacctccccgcc
gcgctcaaatctggcggccggctggtggtgggccattggaccgggcgggggagccggctc
gtgacgctgacccgcgacagcgcggccgcctacgcccggacggagggggcggcgctgcgc
ctcggccctcttacgccgggccgtgcgctggcgccgtag

DBGET integrated database retrieval system