KEGG   Metallosphaera cuprina: Mcup_0337Help
Entry
Mcup_0337         CDS       T01467                                 

Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mcn  Metallosphaera cuprina
Pathway
mcn00340  Histidine metabolism
mcn01100  Metabolic pathways
mcn01110  Biosynthesis of secondary metabolites
mcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mcn00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    Mcup_0337
Enzymes [BR:mcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Mcup_0337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AEB94445
UniProt: F4FZD6
Position
complement(294527..295714)
Genome map
AA seq 395 aa AA seqDB search
MIRREIPKGRVQSFSQVIDKVSEIAQRVRERGDTALRELTLELDGIKLDSLVLDKDYIDG
RASELGDEMREAIDRVWVQLTSFHEIMRPPNVGGGNGKIKYGVIWTALNRVGIYVPGGKK
TYPSTLMMAGIPARVAGVSELFVSTPVRNRLDPAIAYIAQKLKVKAIYPVGGAQAIVAMA
FGTESVSKVDKIIGPGNIYVQAAKYLVSGEVGIDGIEGPTELVVIADDSSDPKRIALDLM
AQGEHGSSSLLVLISDSERILDEVSKLLNEGNEYFLVKVKSLDEAIDIANEIAPEHLSLY
SSRAREYLSKVKNSAAVTLGDTPPALIDYAAGPDHILPTNGWSRFRGGITVFDFLKPISH
VDAEKADENLIRAAMKIAEYEGFSIHARSIGVRYE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
ttgataaggcgagagataccaaaaggaagagtccaatctttttcacaggtgatagacaaa
gtgagcgagatagcgcagagagtcagggaacgaggagacacggcacttagggagcttact
ttagagcttgatggcatcaaattggacagtttggttcttgataaagattacatagatggg
cgagcttcagaacttggggacgagatgagggaggctatagatcgggtttgggttcagtta
acatcgtttcacgaaataatgagacctcctaacgtcggtggaggaaacggaaaaataaaa
tatggcgtcatctggaccgcactgaacagagttggaatttatgtaccaggcggtaagaaa
acctatccttccacactcatgatggcagggatacctgcgagggttgcaggggtgagtgag
ctcttcgtttccactccagtaaggaatcgtttggatcccgcaattgcttatatagcacag
aaattgaaagtgaaggctatctatccggtaggcggtgcccaagctattgtggccatggcc
ttcggcactgagagcgtctccaaagttgataaaataataggtcctggaaacatttacgtt
caagccgctaagtatttagtcagtggggaagtagggattgatggaatcgaaggtcccact
gagttagttgtgatagcggatgatagctctgatcccaagagaatagccctggatttgatg
gctcaaggagaacacgggagctcctctcttctggtcttgatttctgactctgaaaggatc
ttggatgaggtctcgaaattacttaatgaggggaacgaatactttctggttaaagtcaag
tctctagatgaagcgatagatatcgccaacgaaatagcacctgagcatttgtctctttat
agttctagagctagagaatacctttctaaagttaagaattctgctgctgtcacattaggt
gacactcccccagcccttattgactacgctgcaggccctgatcacatattacctaccaac
ggatggtcgaggttcaggggagggattacggttttcgatttccttaagccgatctctcat
gttgatgcggagaaagcggacgagaatctaataagggcagcgatgaagatagccgagtat
gaggggttttcaatacacgcaaggagtataggtgtaagatatgagtaa

DBGET integrated database retrieval system