KEGG   Monodelphis domestica (opossum): 100022730Help
Entry
100022730         CDS       T01031                                 

Definition
(RefSeq) phosphoglycerate mutase 1-like
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Glucagon signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100022730
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100022730
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    100022730
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    100022730
Enzymes [BR:mdo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     100022730
Membrane trafficking [BR:mdo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100022730
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   100022730
  Exosomal proteins of melanoma cells
   100022730
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
8
AA seq 287 aa AA seqDB search
MLSPPGLRHSWISLPAKRFSSNLLSHSLEPGQVMATYKLVLIRHGQSFWNLENRFSGWYD
VDLSPVGHLEAQRCGQELRDAGYVFDICFTSIQKRAIRTLWIMLDVMDQMWLPVVRTWRL
NERHHGELTGLNKAELAAKHGEAQVKMWRRSYNIPPPPMEISHPFYSSITKDRRYADLTE
GQVPSCESIKDSTARGLPFWNEEIFPRIREGKRVLVVAHCICLGGMVKYLEGLSEEAAME
LNLPNCIPIVYELDKNMKPVKPMQFLGDEETLRKAIEAVAAQGKAQK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtcctccaggcttgagacactcctggatctctcttcccgccaagcggtttagc
agtaacctccttagccacagtctcgagcctgggcaggttatggccacctacaagctcgtg
ctgatccggcacggccagagcttctggaacctggagaaccgcttcagtggctggtatgac
gtggacctgagccctgtcgggcacctggaggcccagcgttgcggccaggagctgcgagat
gccggctatgtgtttgatatctgcttcacctccatccagaagagagcgatccggaccctg
tggataatgctagacgtcatggaccagatgtggctgcctgtagtgaggacttggcgcctc
aatgagcggcatcacggagagctgacgggcttaaacaaggcagagctggccgctaagcac
ggggaggctcaggtgaagatgtggcgccgatcttacaacatcccaccacctccaatggag
atcagccaccccttctacagtagcatcaccaaggaccgccgctatgccgatcttacagag
ggtcaagtgccttcctgcgagagcatcaaagactccactgctcggggtctgcccttctgg
aatgaggaaatcttcccccggatcagggaaggaaaacgtgttctggttgtagcccactgc
atttgtctcggagggatggtcaaataccttgagggtctgtctgaagaagcagccatggaa
ctgaatctgcctaattgcattcctatcgtgtatgagttggacaagaatatgaaacctgtc
aagcccatgcagttccttggagatgaagagaccctgcgcaaagccattgaggctgtggct
gcacaaggcaaggcgcagaagtga

DBGET integrated database retrieval system