KEGG   Monodelphis domestica (opossum): 100022730Help
Entry
100022730         CDS       T01031                                 

Definition
(RefSeq) phosphoglycerate mutase 1-like
Organism
mdo  Monodelphis domestica (opossum)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
8
AA seq 287 aa AA seqDB search
MLSPPGLRHSWISLPAKRFSSNLLSHSLEPGQVMATYKLVLIRHGQSFWNLENRFSGWYD
VDLSPVGHLEAQRCGQELRDAGYVFDICFTSIQKRAIRTLWIMLDVMDQMWLPVVRTWRL
NERHHGELTGLNKAELAAKHGEAQVKMWRRSYNIPPPPMEISHPFYSSITKDRRYADLTE
GQVPSCESIKDSTARGLPFWNEEIFPRIREGKRVLVVAHCICLGGMVKYLEGLSEEAAME
LNLPNCIPIVYELDKNMKPVKPMQFLGDEETLRKAIEAVAAQGKAQK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgctcagtcctccaggcttgagacactcctggatctctcttcccgccaagcggtttagc
agtaacctccttagccacagtctcgagcctgggcaggttatggccacctacaagctcgtg
ctgatccggcacggccagagcttctggaacctggagaaccgcttcagtggctggtatgac
gtggacctgagccctgtcgggcacctggaggcccagcgttgcggccaggagctgcgagat
gccggctatgtgtttgatatctgcttcacctccatccagaagagagcgatccggaccctg
tggataatgctagacgtcatggaccagatgtggctgcctgtagtgaggacttggcgcctc
aatgagcggcatcacggagagctgacgggcttaaacaaggcagagctggccgctaagcac
ggggaggctcaggtgaagatgtggcgccgatcttacaacatcccaccacctccaatggag
atcagccaccccttctacagtagcatcaccaaggaccgccgctatgccgatcttacagag
ggtcaagtgccttcctgcgagagcatcaaagactccactgctcggggtctgcccttctgg
aatgaggaaatcttcccccggatcagggaaggaaaacgtgttctggttgtagcccactgc
atttgtctcggagggatggtcaaataccttgagggtctgtctgaagaagcagccatggaa
ctgaatctgcctaattgcattcctatcgtgtatgagttggacaagaatatgaaacctgtc
aagcccatgcagttccttggagatgaagagaccctgcgcaaagccattgaggctgtggct
gcacaaggcaaggcgcagaagtga

DBGET integrated database retrieval system