KEGG   Monodelphis domestica (opossum): 100025595Help
Entry
100025595         CDS       T01031                                 

Definition
protein disulfide-isomerase-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mdo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 510 aa AA seqDB search
MLNRVLLCLALAVMAGVRADAPKEEDDVLVLNKSNFGEALKSYEYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSKIRLAKVDATEESDLARQYGVRGYPTIKFFKNGDTTSPKEYTA
GREAEDIVNWLKKRTSPAVTVLRDVAAAESLVDSSEVAVIGLFKDVDSEFVKQFTLAAES
IDDIPFGISSSNDVYSKYQMDKDGIILLKKFDEGRNNYDGEITKENLMDFVNYHRLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDDKLSNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKIKEFCDRFLEGKVKPHLMSQ
DLPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
SIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLEGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDMEEDDDQTAPKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccgcgtcctgctctgcctagccctggccgtgatggccggggtccgcgctgac
gcccctaaggaagaggacgacgtcctggtcctgaataagagtaacttcggggaggcgttg
aagagctacgagtacctcctagtggagttctatgctccttggtgtggccactgtaaagct
ctagcacctgagtatgccaaggcagctggaaaattgaaggctgaaggttctaaaatcaga
ttggccaaagtagatgccactgaagaatctgatctcgcacggcaatatggggttcggggg
taccctactatcaaattttttaagaatggagatacaacttctcctaaagagtatacagct
ggtagagaagctgaagacattgtgaactggctgaagaaacggactagtccagcagtcact
gtcctgagagatgttgctgctgctgagtccttggtggattccagtgaagttgctgttatt
ggcttattcaaggatgtagattcagaatttgtcaaacagttcacattggctgcagagtcc
atcgatgatatcccatttggaatttcttccagcaatgatgtgtattccaaatatcaaatg
gataaagatggcattatcctccttaagaagtttgatgaaggtagaaacaactacgatgga
gagattaccaaggagaacctaatggattttgttaattatcaccggctgcccttagtcatt
gagttcacggagcagacggcccccaaaatttttggaggtgaaatcaagactcatatcctg
ctgtttctgccaaaaagtgtttctgactatgatgacaaactgagtaacttcaaaaaagca
gcagaaagcttcaaagggaagatcctatttatcttcattgatagtgaccatactgacaac
cagaggatccttgagttctttggcttaaagaaagaggagtgcccagctgtccgcctcatc
actttggaagaggagatgaccaagtacaagcctgagtcagatgaattaacagcagaaaag
ataaaagaattctgtgaccgatttttggaaggcaaagtcaagcctcatttaatgagccag
gacctacctgatgactgggacaagcagcctgttaaagtactagttgggaagaactttgag
gaagttgcttttgatgaaaaaaagaatgtctttgtggaattttatgctccctggtgtggt
cactgcaaacagctggctcccatttgggataaattgggagagacttataaggatcatgaa
agtatagtcattgccaagatggactcaacggctaatgaagtagaggcagttaaggttcac
agtttccctacgttaaagttcttccctgcaagtgctgacagaacggtaattgattacaat
ggagagagaacactagaaggtttcaaaaagttcctggagagtggtggacaagatggggca
ggggatgatgacgatctagaagatttggaagaagctgaagagccagatatggaagaagat
gatgatcagacagctccaaaagatgaattgtaa

DBGET integrated database retrieval system