KEGG   Monodelphis domestica (opossum): 100025595Help
Entry
100025595         CDS       T01031                                 

Gene name
P4HB
Definition
prolyl 4-hydroxylase, beta polypeptide
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100025595 (P4HB)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100025595 (P4HB)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100025595 (P4HB)
  Exosomal proteins of colorectal cancer cells
   100025595 (P4HB)
  Exosomal proteins of bladder cancer cells
   100025595 (P4HB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 510 aa AA seqDB search
MLNRVLLCLALAVMAGVRADAPKEEDDVLVLNKSNFGEALKSYEYLLVEFYAPWCGHCKA
LAPEYAKAAGKLKAEGSKIRLAKVDATEESDLARQYGVRGYPTIKFFKNGDTTSPKEYTA
GREAEDIVNWLKKRTSPAVTVLRDVAAAESLVDSSEVAVIGLFKDVDSEFVKQFTLAAES
IDDIPFGISSSNDVYSKYQMDKDGIILLKKFDEGRNNYDGEITKENLMDFVNYHRLPLVI
EFTEQTAPKIFGGEIKTHILLFLPKSVSDYDDKLSNFKKAAESFKGKILFIFIDSDHTDN
QRILEFFGLKKEECPAVRLITLEEEMTKYKPESDELTAEKIKEFCDRFLEGKVKPHLMSQ
DLPDDWDKQPVKVLVGKNFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKDHE
SIVIAKMDSTANEVEAVKVHSFPTLKFFPASADRTVIDYNGERTLEGFKKFLESGGQDGA
GDDDDLEDLEEAEEPDMEEDDDQTAPKDEL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaccgcgtcctgctctgcctagccctggccgtgatggccggggtccgcgctgac
gcccctaaggaagaggacgacgtcctggtcctgaataagagtaacttcggggaggcgttg
aagagctacgagtacctcctagtggagttctatgctccttggtgtggccactgtaaagct
ctagcacctgagtatgccaaggcagctggaaaattgaaggctgaaggttctaaaatcaga
ttggccaaagtagatgccactgaagaatctgatctcgcacggcaatatggggttcggggg
taccctactatcaaattttttaagaatggagatacaacttctcctaaagagtatacagct
ggtagagaagctgaagacattgtgaactggctgaagaaacggactagtccagcagtcact
gtcctgagagatgttgctgctgctgagtccttggtggattccagtgaagttgctgttatt
ggcttattcaaggatgtagattcagaatttgtcaaacagttcacattggctgcagagtcc
atcgatgatatcccatttggaatttcttccagcaatgatgtgtattccaaatatcaaatg
gataaagatggcattatcctccttaagaagtttgatgaaggtagaaacaactacgatgga
gagattaccaaggagaacctaatggattttgttaattatcaccggctgcccttagtcatt
gagttcacggagcagacggcccccaaaatttttggaggtgaaatcaagactcatatcctg
ctgtttctgccaaaaagtgtttctgactatgatgacaaactgagtaacttcaaaaaagca
gcagaaagcttcaaagggaagatcctatttatcttcattgatagtgaccatactgacaac
cagaggatccttgagttctttggcttaaagaaagaggagtgcccagctgtccgcctcatc
actttggaagaggagatgaccaagtacaagcctgagtcagatgaattaacagcagaaaag
ataaaagaattctgtgaccgatttttggaaggcaaagtcaagcctcatttaatgagccag
gacctacctgatgactgggacaagcagcctgttaaagtactagttgggaagaactttgag
gaagttgcttttgatgaaaaaaagaatgtctttgtggaattttatgctccctggtgtggt
cactgcaaacagctggctcccatttgggataaattgggagagacttataaggatcatgaa
agtatagtcattgccaagatggactcaacggctaatgaagtagaggcagttaaggttcac
agtttccctacgttaaagttcttccctgcaagtgctgacagaacggtaattgattacaat
ggagagagaacactagaaggtttcaaaaagttcctggagagtggtggacaagatggggca
ggggatgatgacgatctagaagatttggaagaagctgaagagccagatatggaagaagat
gatgatcagacagctccaaaagatgaattgtaa

DBGET integrated database retrieval system