KEGG   Monodelphis domestica (opossum): 100619627Help
Entry
100619627         CDS       T01031                                 

Definition
laminin subunit beta-2-like
Orthology
K06243  
laminin, beta 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    100619627
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    100619627
 Cellular Processes
  Cell communication
   04510 Focal adhesion
    100619627
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100619627
   05222 Small cell lung cancer
    100619627
  Infectious diseases
   05146 Amoebiasis
    100619627
   05145 Toxoplasmosis
    100619627
Cell adhesion molecules and their ligands [BR:mdo04516]
 2. Integrin Family
  Beta1 integrins
   VLA-3
    ITGB1; integrin beta 1 [KO:K05719]
     Laminin-11 Extracellular matrix (ECM) components
      100619627
   VLA-6
      100619627
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1833 aa AA seqDB search
MSRVKSPLPLDLLVSRGVKHFAVLGSSLDLGWAGGVWCIVQITYVCAHEVPDLLPRPGCS
GGSCYPPTGNLVVGRSQSLHASSTCGLSGPEPYCIVSHLQDSEKCFFCDSRGQGGHRINN
VISLSGPDGERTWWQAESGVENVSIQLDLEGEFYFTHLIMTFKTFRPAGLLIERSADGGH
SWRVYRYYAHNCSGLFPGVPLTPGRKVSDLVCDQRYSNIEPSSQGEVIFKVLDPAIPVAD
PYSPEIQELLRVTNLRVNFSKLHTLGDGPLGAWGHRHGPHYYYALYELVVRGSCLCHGHA
SECAPAPGAPPSVDGMVHGLCVCQHRTTGPHCERCQDLHHDQPWHPAEPGNPHACQKCEC
HQHARSCHFDMAVFVASGNVSGGVCDACQHHTAGRHCEICRPFYHRDPREDPRSPYTCKS
CDCDPSGTLDGGLCDTHTDEVLGLLSGQCRCKAHVWGPRCDTCRPGYYGLSPALPEGCLS
CRCDPRGTVPGDTPCDPISGDCYCKRFVTGQNCHQCLPEFWGLSNDFTGCRPCDCDFGGA
YSNRCSSGEGLCPCRPHLQGRNCLELQSGYFCAALDQAIAEAELGQRLKPSDPRLPGSLL
PDATPNCLPTTGPVLKRLRPRLRRQRSIACPLPITRRGRHSHQLSKVKNRGPHTSSWTGS
GFARIEDRAGLMLQAPSVPRAMEYDIVLRYEAQAPEDWEALVSVRAYSLPSSTRCANVLP
SEQLYQVALPPRHRAVVLSRPFCFEPGTRYMVTLRLRRVTSTRGLAGGTILLDSLVLLPR
VEELPGLRRGDPGASGRLRELGQTQCLEAARTPPLGPPSESCARLVCSISALLYGGGLAC
ECDPQGSLSSECARVGGQCPCRPHVIGQRCDQCELQTYGFGPAGCSECRCSPEGSTSLAC
DPISGQCLCKPGITGRRCDQCLPGQWGFPHCQPCECNGHAEQCHPHTGVCWACGDATTGR
HCERCQDGYYGDPVLGSGQQCRPCPCPGFLGSGNYHGTSCQADGGSERILCVCAPGYAGP
RCDRCSAGYFGRPWPEGVVGGAPCRPCQCNNNIDPSDPMACDPHSGHCQRCLHHTHGPHC
SHCQPGYYGNALRPRGCRRCSCDLQGTVPARCLPGSGICFCDRLSGYCPCRPHVLGRLCD
RCAPQFWNLGGPRGCEPCACHAQHSLQLTCHPVTGQCPCQEGFGGRTCSQCQEGYWGDPE
KECRACACDPQGSVSLHCHPRTGACSCLNGISGPQCKACVRGSQGSFPHCRPCPTCFSHW
DSRLSRLQQRLATLAQGRDALSEAATDRSSGGRLLSLEAALGHVQGVLVSTSPLVGPLQQ
LSKQRDGLRREAAMLGRALRGVERSVAVSGPWARAQHARIGQLTEEMEHLNRLATQLREA
PQGAQDAVSLVSKAALISQKAEFGIIVTTALTNTESALSQSRNVRRRTEGLLQEMKPPSR
AAAWGEQLQALVNASWALNPSLAQLKVCGGPWGMGRACALSPCGPASCSGALPTSLWALG
TAQNTSHALGTTSTRLGRLHRRLQRVGTVAGAAHSQAEETLSRARATWYGAGTASMLATI
QRIRAFLTDEGADPESVELVAQRVLKIPLPQGGQRAIEQLLEEIQDALQLPDSMDWALPS
AQDLLRQAQWAREDAGRTQDNVMKTQGVLTEAQNNVGRAEKQLRKTKQALRSLEVQTQEV
ALGLVQVAHDLDVGPTLDQLLGAADALQAQVSQNKLQLQEAQEQAEQASDTAANLGKDLQ
TAKLQFSELQSGINGLGDEVNGARHRLQRIQAEARELLKKASRSRNRLEGLEKRFALNEQ
ALGEKAAELQTLESRALGLLEQLRQEASAHATC
NT seq 5502 nt NT seq  +upstreamnt  +downstreamnt
atgagtagagtgaagtctcccctacctctggatttgctggtctcaagaggtgtgaagcat
tttgcagttctggggagcagcctggatttgggttgggcagggggagtctggtgcatcgta
cagataacctatgtctgtgcccatgaagtgcctgaccttctacctcgacctggctgctct
ggaggaagctgttaccctcccactggcaatctagttgtaggcaggagccaaagtctccat
gcctcatccacctgtggtttgagtgggcctgagccctactgcattgtcagccacttgcag
gactctgagaaatgcttcttctgtgattcaaggggccagggaggccatagaatcaataat
gtgatctccttgagtggacctgatggagaaagaacatggtggcaggcagagagtggtgtg
gaaaatgtcagtatccagctggacttggaaggggagttctactttacccaccttatcatg
accttcaagacttttcgcccagctggtctactcattgaacgttcagcagatgggggtcat
tcctggcgagtttatcgatactatgctcacaactgctctggcctctttcctggggtacct
cttacacctggccgcaaagtcagtgacctcgtttgtgatcagcgatactcaaacattgaa
ccatcaagtcagggtgaggtaatttttaaagttctggacccagctatccctgtggcagat
ccctatagtccagagatccaagagttgcttcgagttaccaacctgagggtgaatttctcc
aaactacacacgctgggagatgggcccctgggggcctggggccaccgccatgggcctcac
tactactatgccttgtatgagcttgtggtccgaggaagctgcctatgccatggacatgcc
tctgaatgtgcacctgctcctggtgccccaccaagtgtggatggcatggtacatgggctt
tgtgtgtgtcagcatcggacaactggaccccactgtgagcgctgccaggaccttcatcat
gaccaaccctggcacccagctgagcctgggaatccccatgcctgccagaagtgtgaatgc
caccagcatgccaggagttgccactttgacatggctgtctttgtggcttcaggcaatgtg
agtggaggtgtgtgtgatgcatgtcagcaccacacagctgggaggcactgtgagatttgc
cgacccttctaccaccgagacccccgtgaagacccccgatccccatatacctgtaaatca
tgtgactgtgacccttcaggcactttggatgggggtctctgtgacacacacacagatgag
gtcctggggcttctctctggacagtgtcgatgcaaagcccacgtgtggggcccacgctgt
gatacctgtcgtcctggttactatggcctgagcccagcactgcctgaaggttgtttatct
tgcaggtgtgatccacggggcacagttccaggtgacaccccctgcgaccctatcagtggt
gactgctattgtaagcgttttgtcactggccagaactgtcaccagtgcctgccagaattc
tggggactaagcaatgactttactggttgccggccttgtgactgtgattttggaggagcc
tatagcaacaggtgctcatcaggggaaggcctttgtccttgccgccctcacttacaaggt
cggaactgccttgagctccagtctggttatttctgtgcagccctggaccaagccatagct
gaggcagagcttgggcagagactcaagccctctgacccacggctacctggatcccttttg
cctgatgccacccccaactgcctgccaacaacaggacccgtgctgaagaggctcagaccc
cggctccggcgccaacgtagcatcgcctgccctctccctattactcgtcgtggacgtcac
agccaccaactatccaaggtgaagaacaggggccctcatacctcatcttggacaggctct
gggtttgccaggattgaagacagggctggtctcatgctccaggctccttcagtgccacga
gccatggagtatgacattgtgctacgttatgaagctcaggcccctgaggactgggaggcc
cttgtcagtgtacgagcctactctctgcccagcagcactcgttgtgccaacgtgttgccc
tcagagcaactctaccaggtggccctacctcccaggcacagagctgtggttctatctaga
cccttctgctttgaacctggaaccagatacatggtgaccttgagacttcgtcgagtgaca
agtacacggggcctcgctgggggaaccattctgctagactcactggtgctcctacctcga
gtagaggagcttccaggtctgagaagaggggaccccggggcatcagggcgcctgagagaa
ctcggtcaaactcagtgccttgaggctgcaagaacacctccacttgggcccccatcagaa
tcttgtgcccgcttggtctgtagcatctctgctctactatatggtggtggcttggcctgt
gaatgtgacccacaaggttctctgagctctgagtgtgcccgtgtggggggccagtgccca
tgccgacctcatgtcattggccagcgctgtgaccagtgtgagctccagacatatggcttt
ggcccagcaggttgcagtgaatgtcgttgctctcctgaggggtctaccagtttggcctgt
gatcctataagtggacagtgcttatgcaagccaggcatcacaggacgaaggtgtgaccaa
tgcctgcctggccagtggggattccctcactgccagccatgtgagtgtaatgggcatgca
gagcagtgccacccacacacaggtgtatgctgggcctgtggagatgccaccactgggcgt
cactgtgaaaggtgccaggatggttattatggagaccctgtcctgggctcaggacagcag
tgccggccttgtccctgccctgggttcctaggctctggtaactaccatgggacctcatgt
caggcggatggtggtagtgaacgaattctgtgtgtctgtgctcctggttatgcaggtcct
cgttgtgaccgatgctctgctggatactttgggcgtccctggccagagggagtagtgggg
ggagcaccatgccgaccctgccagtgcaacaacaacattgatcctagtgaccccatggcc
tgtgacccccatagtgggcactgtcagcgctgtctacaccacacccatgggccacactgt
tcacactgccagcctggatactatggcaatgccctccggccacgaggctgccggcgctgc
agctgtgacctacaaggcacagtgcctgcccggtgcctgcctggaagtggcatctgcttc
tgtgataggctcagtgggtactgcccctgccgcccacatgtcctaggacgactctgtgac
cgctgtgctccccagttctggaacctgggagggcctcggggctgtgagccctgtgcttgt
catgcccagcactccctgcagctcacctgtcatccagtcactggtcagtgcccatgccag
gaaggatttggaggacgtacctgctcacagtgccaggaagggtactggggggacccagag
aaggagtgcagagcttgtgcctgtgaccctcagggctcagtctctctgcattgccaccct
aggacgggggcctgctcatgtctcaatggtatctcaggccctcagtgtaaggcctgtgtc
cggggttctcagggcagtttcccccactgccggccctgtccaacttgcttctctcactgg
gatagccgactaagtcgcctccagcagcggctggccacactggctcaggggagggatgcc
ctgagtgaggcagctactgaccggagcagtggggggcggttgctgtccctggaggctgcc
ctgggacacgtccaaggagtcttggtgtccacctcccccctggtggggcccttgcagcag
ctttcaaaacagcgggatggactcaggagggaggcagccatgctgggtcgagcacttcga
ggggtggaacgcagtgtggctgtgagtggtccctgggctagagctcagcatgcccgcata
ggccagctgacagaagaaatggaacatcttaatcgcttggccacccagctcagagaggcc
cctcagggagcccaggatgctgtttccctagtctccaaggctgctctcatctcccagaag
gctgaatttggtatcatagtcacaactgccctgacaaacacagagagtgccctgagccaa
tcccgtaatgtccggcgcagaacagaggggctgttgcaagaaatgaagcctcccagcagg
gcagctgcttggggggagcagctccaagcacttgtgaatgcctcctgggccctgaacccc
agcctggcccagctcaaggtctgtgggggaccatggggtatggggagggcctgtgctctc
tccccctgtgggccagcctcttgttctggagcattgcccacttccctgtgggcacttgga
actgctcaaaacacatcccatgctttgggtaccacaagtaccagattggggcggctacat
cgacggctacaacgggttgggaccgtggcaggggctgcccactcacaagctgaggaaaca
ctgagccgagctcgagccacgtggtatggggctggcactgcctccatgttggccactatc
cagaggatccgggccttcctcacagatgagggtgcagaccctgagagtgtggagctggtg
gcccaaagggtcctgaaaattcctctgccccaggggggccagagagctatagaacagctg
ttggaagagatccaagatgccctccaacttccagatagtatggactgggctctgccttca
gcccaggacctccttcggcaagcccaatgggccagggaggatgcaggcagaacccaggac
aatgtaatgaagacccagggagttctaactgaggcccagaacaatgtaggaagagctgag
aaacagcttcggaaaaccaagcaggccctgcggagcctagaggttcagacacaggaggta
gccttagggctagttcaggtggcacatgatctggatgtaggtcccaccctggaccagctc
ctgggagcagctgatgctctacaagcccaggtgtcacaaaataaactacagctacaggag
gcccaggagcaagcagaacaagcatcagacacagctgcgaacttgggcaaggacctgcag
acagccaagctacagttctcagagctacagtctgggatcaatggccttggggatgaagtg
aatggggccagacatcgtttgcagcgaattcaggcagaagccagagagctgctgaagaaa
gcaagtaggagccgaaaccgtctagaaggcctggagaaacgttttgctctgaatgagcag
gcacttggagagaaggcagctgagcttcagaccctggagagtagagccctgggactactg
gagcagctgagacaggaggccagtgcccacgccacctgctga

DBGET integrated database retrieval system