KEGG   Monodelphis domestica (opossum): 100619627Help
Entry
100619627         CDS       T01031                                 

Definition
laminin subunit beta-1-like
Orthology
K06243  
laminin, beta 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Toxoplasmosis
Amoebiasis
Pathways in cancer
Small cell lung cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mdo04512]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mdo05222]
Human Diseases; Infectious diseases; Amoebiasis [PATH:mdo05146]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mdo05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1703 aa AA seqDB search
MRICDVRYAVVALQITYVCAHEVPDLLPRPGCSGGSCYPPTGNLVVGRSQSLHASSTCGL
SGPEPYCIVSHLQDSEKCFFCDSRGQGGHRINNVISLSGPDGERTWWQAESGVENVSIQL
DLEGEFYFTHLIMTFKTFRPAGLLIERSADGGHSWRVYRYYAHNCSGLFPGVPLTPGRKV
SDLVCDQRYSNIEPSSQGEVIFKVLDPAIPVADPYSPEIQELLRVTNLRVNFSKLHTLGD
GPLGAWGHRHGPHYYYALYELVVRGSCLCHGHASECAPAPGAPPSVDGMVHGLCVCQHRT
TGPHCERCQDLHHDQPWHPAEPGNPHACQKCECHQHARSCHFDMAVFVASGNVSGGVCDA
CQHHTAGRHCEICRPFYHRDPREDPRSPYTCKSCDCDPSGTLDGGLCDTHTDEVLGLLSG
QCRCKAHVWGPRCDTCRPGYYGLSPALPEGCLSCRCDPRGTVPGDTPCDPISGDCYCKRF
VTGQNCHQCLPEFWGLSNDFTGCRPCDCDFGGAYSNRCSSGEGLCPCRPHLQGRNCLELQ
SGYFCAALDQAIAEAELGQRLKPSDPRLPVPLEDSTGLEILGPHTSSWTGSGFARIEDRA
GLMLQAPSVPRAMEYDIVLRYEAQAPEDWEALVSVRAYSLPSSTRCANVLPSEQLYQVAL
PPRHRAVVLSRPFCFEPGTRYMVTLRLRRVTSTRGLAGGTILLDSLVLLPRVEELPGLRR
GDPGASGRLRELGQTQCLEAARTPPLGPPSESCARLVCSISALLYGGGLACECDPQGSLS
SECARVGGQCPCRPHVIGQRCDQCELQTYGFGPAGCSECRCSPEGSTSLACDPISGQCLC
KPGITGRRCDQCLPGQWGFPHCQPCECNGHAEQCHPHTGVCWACGDATTGRHCERCQDGY
YGDPVLGSGQQCRPCPCPGFLGSGNYHGTSCQADGGSERILCVCAPGYAGPRCDRCSAGY
FGRPWPEGVVGGAPCRPCQCNNNIDPSDPMACDPHSGHCQRCLHHTHGPHCSHCQPGYYG
NALRPRGCRRCSCDLQGTVPARCLPGSGICFCDRLSGYCPCRPHVLGRLCDRCAPQFWNL
GGPRGCEPCACHAQHSLQLTCHPVTGQCPCQEGFGGRTCSQCQEGYWGDPEKECRACACD
PQGSVSLHCHPRTGACSCLNGISGPQCKACVRGSQGSFPHCRPCPTCFSHWDSRLSRLQQ
RLATLAQGRDALSEAATDRSSGGRLLSLEAALGHVQGVLVSTSPLVGPLQQLSKQRDGLR
REAAMLGRALRGVERSVAVSGPWARAQHARIGQLTEEMEHLNRLATQLREAPQGAQVSKA
ALISQKAEFGIIVTTALTNTESALSQSRNVRRRTEGLLQEMKPPSRAAAWGEQLQALVNA
SWALNPSLAQLKLQRVGTVAGAAHSQAEETLSRARATWYGAGTASMLATIQRIRAFLTDE
GADPESVELVAQRVLKIPLPQGGQRAIEQLLEEIQDALQLPDSMDWALPSAQDLLRQAQW
AREDAGRTQDNVMKTQGVLTEAQNNVGRAEKQLRKTKQALRSLEVQTQEVALGLVQVAHD
LDVGPTLDQLLGAADALQAQVSQNKLQLQEAQEQAEQASDTAANLGKDLQTAKLQFSELQ
SGINGLGDEVNGARHRLQRIQAEARELLKKASRSRNRLEGLEKRFALNEQALGEKAAELQ
TLESRALGLLEQLRQEASAHATC
NT seq 5112 nt NT seq  +upstreamnt  +downstreamnt
atgcggatctgtgatgttcggtatgcagttgtggccttacagataacctatgtctgtgcc
catgaagtgcctgaccttctacctcgacctggctgctctggaggaagctgttaccctccc
actggcaatctagttgtaggcaggagccaaagtctccatgcctcatccacctgtggtttg
agtgggcctgagccctactgcattgtcagccacttgcaggactctgagaaatgcttcttc
tgtgattcaaggggccagggaggccatagaatcaataatgtgatctccttgagtggacct
gatggagaaagaacatggtggcaggcagagagtggtgtggaaaatgtcagtatccagctg
gacttggaaggggagttctactttacccaccttatcatgaccttcaagacttttcgccca
gctggtctactcattgaacgttcagcagatgggggtcattcctggcgagtttatcgatac
tatgctcacaactgctctggcctctttcctggggtacctcttacacctggccgcaaagtc
agtgacctcgtttgtgatcagcgatactcaaacattgaaccatcaagtcagggtgaggta
atttttaaagttctggacccagctatccctgtggcagatccctatagtccagagatccaa
gagttgcttcgagttaccaacctgagggtgaatttctccaaactacacacgctgggagat
gggcccctgggggcctggggccaccgccatgggcctcactactactatgccttgtatgag
cttgtggtccgaggaagctgcctatgccatggacatgcctctgaatgtgcacctgctcct
ggtgccccaccaagtgtggatggcatggtacatgggctttgtgtgtgtcagcatcggaca
actggaccccactgtgagcgctgccaggaccttcatcatgaccaaccctggcacccagct
gagcctgggaatccccatgcctgccagaagtgtgaatgccaccagcatgccaggagttgc
cactttgacatggctgtctttgtggcttcaggcaatgtgagtggaggtgtgtgtgatgca
tgtcagcaccacacagctgggaggcactgtgagatttgccgacccttctaccaccgagac
ccccgtgaagacccccgatccccatatacctgtaaatcatgtgactgtgacccttcaggc
actttggatgggggtctctgtgacacacacacagatgaggtcctggggcttctctctgga
cagtgtcgatgcaaagcccacgtgtggggcccacgctgtgatacctgtcgtcctggttac
tatggcctgagcccagcactgcctgaaggttgtttatcttgcaggtgtgatccacggggc
acagttccaggtgacaccccctgcgaccctatcagtggtgactgctattgtaagcgtttt
gtcactggccagaactgtcaccagtgcctgccagaattctggggactaagcaatgacttt
actggttgccggccttgtgactgtgattttggaggagcctatagcaacaggtgctcatca
ggggaaggcctttgtccttgccgccctcacttacaaggtcggaactgccttgagctccag
tctggttatttctgtgcagccctggaccaagccatagctgaggcagagcttgggcagaga
ctcaagccctctgacccacggctacctgtgccattggaggactccactggcttagagatt
ttgggccctcatacctcatcttggacaggctctgggtttgccaggattgaagacagggct
ggtctcatgctccaggctccttcagtgccacgagccatggagtatgacattgtgctacgt
tatgaagctcaggcccctgaggactgggaggcccttgtcagtgtacgagcctactctctg
cccagcagcactcgttgtgccaacgtgttgccctcagagcaactctaccaggtggcccta
cctcccaggcacagagctgtggttctatctagacccttctgctttgaacctggaaccaga
tacatggtgaccttgagacttcgtcgagtgacaagtacacggggcctcgctgggggaacc
attctgctagactcactggtgctcctacctcgagtagaggagcttccaggtctgagaaga
ggggaccccggggcatcagggcgcctgagagaactcggtcaaactcagtgccttgaggct
gcaagaacacctccacttgggcccccatcagaatcttgtgcccgcttggtctgtagcatc
tctgctctactatatggtggtggcttggcctgtgaatgtgacccacaaggttctctgagc
tctgagtgtgcccgtgtggggggccagtgcccatgccgacctcatgtcattggccagcgc
tgtgaccagtgtgagctccagacatatggctttggcccagcaggttgcagtgaatgtcgt
tgctctcctgaggggtctaccagtttggcctgtgatcctataagtggacagtgcttatgc
aagccaggcatcacaggacgaaggtgtgaccaatgcctgcctggccagtggggattccct
cactgccagccatgtgagtgtaatgggcatgcagagcagtgccacccacacacaggtgta
tgctgggcctgtggagatgccaccactgggcgtcactgtgaaaggtgccaggatggttat
tatggagaccctgtcctgggctcaggacagcagtgccggccttgtccctgccctgggttc
ctaggctctggtaactaccatgggacctcatgtcaggcggatggtggtagtgaacgaatt
ctgtgtgtctgtgctcctggttatgcaggtcctcgttgtgaccgatgctctgctggatac
tttgggcgtccctggccagagggagtagtggggggagcaccatgccgaccctgccagtgc
aacaacaacattgatcctagtgaccccatggcctgtgacccccatagtgggcactgtcag
cgctgtctacaccacacccatgggccacactgttcacactgccagcctggatactatggc
aatgccctccggccacgaggctgccggcgctgcagctgtgacctacaaggcacagtgcct
gcccggtgcctgcctggaagtggcatctgcttctgtgataggctcagtgggtactgcccc
tgccgcccacatgtcctaggacgactctgtgaccgctgtgctccccagttctggaacctg
ggagggcctcggggctgtgagccctgtgcttgtcatgcccagcactccctgcagctcacc
tgtcatccagtcactggtcagtgcccatgccaggaaggatttggaggacgtacctgctca
cagtgccaggaagggtactggggggacccagagaaggagtgcagagcttgtgcctgtgac
cctcagggctcagtctctctgcattgccaccctaggacgggggcctgctcatgtctcaat
ggtatctcaggccctcagtgtaaggcctgtgtccggggttctcagggcagtttcccccac
tgccggccctgtccaacttgcttctctcactgggatagccgactaagtcgcctccagcag
cggctggccacactggctcaggggagggatgccctgagtgaggcagctactgaccggagc
agtggggggcggttgctgtccctggaggctgccctgggacacgtccaaggagtcttggtg
tccacctcccccctggtggggcccttgcagcagctttcaaaacagcgggatggactcagg
agggaggcagccatgctgggtcgagcacttcgaggggtggaacgcagtgtggctgtgagt
ggtccctgggctagagctcagcatgcccgcataggccagctgacagaagaaatggaacat
cttaatcgcttggccacccagctcagagaggcccctcagggagcccaggtctccaaggct
gctctcatctcccagaaggctgaatttggtatcatagtcacaactgccctgacaaacaca
gagagtgccctgagccaatcccgtaatgtccggcgcagaacagaggggctgttgcaagaa
atgaagcctcccagcagggcagctgcttggggggagcagctccaagcacttgtgaatgcc
tcctgggccctgaaccccagcctggcccagctcaagctacaacgggttgggaccgtggca
ggggctgcccactcacaagctgaggaaacactgagccgagctcgagccacgtggtatggg
gctggcactgcctccatgttggccactatccagaggatccgggccttcctcacagatgag
ggtgcagaccctgagagtgtggagctggtggcccaaagggtcctgaaaattcctctgccc
caggggggccagagagctatagaacagctgttggaagagatccaagatgccctccaactt
ccagatagtatggactgggctctgccttcagcccaggacctccttcggcaagcccaatgg
gccagggaggatgcaggcagaacccaggacaatgtaatgaagacccagggagttctaact
gaggcccagaacaatgtaggaagagctgagaaacagcttcggaaaaccaagcaggccctg
cggagcctagaggttcagacacaggaggtagccttagggctagttcaggtggcacatgat
ctggatgtaggtcccaccctggaccagctcctgggagcagctgatgctctacaagcccag
gtgtcacaaaataaactacagctacaggaggcccaggagcaagcagaacaagcatcagac
acagctgcgaacttgggcaaggacctgcagacagccaagctacagttctcagagctacag
tctgggatcaatggccttggggatgaagtgaatggggccagacatcgtttgcagcgaatt
caggcagaagccagagagctgctgaagaaagcaagtaggagccgaaaccgtctagaaggc
ctggagaaacgttttgctctgaatgagcaggcacttggagagaaggcagctgagcttcag
accctggagagtagagccctgggactactggagcagctgagacaggaggccagtgcccac
gccacctgctga

DBGET integrated database retrieval system