KEGG   Methylobacterium extorquens AM1: Mex_1p4281Help
Entry
Mex_1p4281        CDS       T00921                                 

Gene name
pncA
Definition
nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mea  Methylobacterium extorquens AM1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mea00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Mex_1p4281 (pncA)
Enzymes [BR:mea01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Mex_1p4281 (pncA)
    3.5.1.-  
     Mex_1p4281 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4373612..4374238
Genome map
AA seq 208 aa AA seqDB search
MMLTDTDVLLVIDVQNDFLPGGALAVPDGDAVVAPINRLAACVPHVTLTQDWHPPGHASF
HGSHPGKAPFDTTDLSYGEQVLWPEHCVQGTHGAELAAGLRTERAELVIRKGTHPGIDSY
SAFMEADRRTRTGLAGYLAERGLTRLFLAGLATDFCVLWTALDARAAGFEAFVIEDAVRG
IDLDGSLARAWNEMERAGVGRTASSALG
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgatgctcacagacaccgacgttctgctcgttatcgacgtgcagaacgattttctgccc
ggcggggcgctcgcggtgcccgacggcgatgccgtcgtcgccccgatcaaccggctggcc
gcgtgcgttccccacgtcaccctcacccaggactggcacccgcccgggcatgcctcgttc
cacgggagccatccgggcaaggcacccttcgacaccacggacctgtcctacggtgaacag
gtgctctggccggagcactgcgtgcagggcacgcacggcgccgagttggccgcgggcctc
aggacggagcgggccgaactggtgatccgcaagggcactcaccccggcatcgacagctac
tcggccttcatggaagccgaccggcggacccgcaccgggttggccggctacctcgccgag
cgcggcctgacccgcctgttcctcgccggcctcgccaccgatttctgcgtgctctggacc
gcgctggatgcccgcgccgccgggttcgaggccttcgtgatcgaggatgccgtgcgcggc
atcgatctcgacggctcgctggcgcgggcctggaacgagatggagcgggcgggggtcggg
cgcaccgccagctcggcgctcggctga

DBGET integrated database retrieval system