KEGG   Methanobacterium sp. AL-21: Metbo_0361Help
Entry
Metbo_0361        CDS       T01437                                 

Definition
tetrahydromethanopterin S-methyltransferase subunit H (EC:2.1.1.86)
Orthology
K00584  
tetrahydromethanopterin S-methyltransferase subunit H [EC:2.1.1.86]
Organism
mel  Methanobacterium sp. AL-21
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogenesis, CO2 => methane
Methanogen
Class
Metabolism; Overview; Carbon metabolism [PATH:mel01200]
Metabolism; Energy metabolism; Methane metabolism [PATH:mel00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
344639..345571
Genome map
AA seq 310 aa AA seqDB search
MFRFDKEQVVLDVAGLKVGGQPGEYPTVLAGTIFYGGHKIISDEKAGTFDKDKAEGLIKM
QEEMADVTGNPHIVHTFGATPEALVKYLEFVGDTTDAPFFIDSTSGEARMAGAKYVTETG
LADRGIYNSLNMSADEEELKVLTECDITSSIVLGFNPMEAGVEGKINIWDNGGSVLDKGL
LDMAADCGIDKPFMDVAVTPLGQGAGPALRTSFAVKSKWGYPVGSGIHNVPSAWDWLRGY
KKENREVWPVSDIGSNLLQVAAGGDFVLMGPIENAKMAFTAVAMTDMFMAEAAKDIGTEP
IETHPFNKLL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtttagatttgacaaagaacaggttgtattagatgttgctggcctcaaagtaggtgga
cagccaggtgaatacccaactgttttagcaggaaccatcttctacggtggacacaagatt
attagtgatgaaaaagcaggaaccttcgacaaagataaagctgaaggtttaataaaaatg
caggaagaaatggcggacgtaaccggaaacccacatattgtacacacttttggtgcaaca
ccagaagctttagtaaaatatctggaatttgtcggagacacaacagacgcacctttcttc
attgactcaacatccggagaagccaggatggctggagcaaaatatgttacagaaactggt
ttagctgacaggggtatatacaactccctgaacatgtctgctgatgaagaagaacttaaa
gttcttactgaatgtgatattacctcttccattgttcttgggttcaacccaatggaagca
ggagtagaaggtaaaatcaacatctgggacaatggtggaagtgtattagacaaaggtctg
cttgacatggcagctgactgtggaatagacaaaccattcatggatgtagcagttacacca
ttaggacaaggtgcaggtcctgcattaaggacttcctttgctgttaaaagcaaatgggga
tacccagtaggtagtggaatccacaacgtgccatctgcatgggactggttaagaggctac
aaaaaggaaaacagagaagtatggcctgttagtgacataggctccaacctactgcaagta
gcagctggaggagactttgtcctcatgggacctatagaaaacgccaaaatggcatttaca
gcagttgcaatgaccgatatgttcatggcagaagctgctaaagatataggtaccgagcca
atagaaacccacccattcaacaaactgttataa

DBGET integrated database retrieval system