KEGG   Methylobacterium extorquens PA1: Mext_4557Help
Entry
Mext_4557         CDS       T00640                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
mex  Methylobacterium extorquens PA1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mex00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mext_4557
Enzymes [BR:mex01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mext_4557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5086803..5087795
Genome map
AA seq 330 aa AA seqDB search
MLTLRPTPGNPVPPGARLVPVETADGVSLRAATWQPTTRSMKGTVCLLQGRAEFIEKYFE
TISDLRARGFCVVAFDWRGQGDSGRQVRDAHKGHVRHFDDYRLDLKAITETVLVPMMPEP
HFGLAHSMGGAVALTLAAEGRLPFRRLVTVAPMLAIRMVRWPAGASLLARGLQRLGLGRC
YIPFGTAVSIATKPFAGNRLSTDPVRYARNAEAARAVGAGAVGDPTIAWLAAAFRAMRRL
ADPALIRRIRTPCLIVAAGADPVCSTPAVERFAARLKTGHLIVLPGARHEILTECDAVRA
DFWAAFDAFIPGHLVHSAVGEAAPHATVAG
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccctgcgtcccacccccggtaatccggtgccgcccggcgcccgcctcgtgccg
gtcgagaccgccgacggcgtctccttgcgggccgcgacgtggcagccgacgacgcgcagc
atgaagggcacggtctgcctgcttcagggccgggccgagttcatcgagaagtatttcgag
acgatcagcgacctgcgcgcccgcggcttctgcgtggtcgccttcgactggcgcggccag
ggcgattccggccgtcaggtccgcgacgcccacaagggccatgtccgccacttcgatgat
taccgcctcgatttgaaggcgatcaccgagaccgtgctcgtgccgatgatgcccgagccg
catttcgggctcgcccattccatgggcggggcggtggcgctgacactcgcggcggagggc
cggctgccgttccggcggctcgtcaccgtcgccccgatgctggcgatccgcatggtgcgc
tggccggcgggcgcctcgctgctggcgcggggcctgcagcggctcgggctcgggcgctgc
tacatccccttcggcacggccgtctcgatcgccacgaagccgttcgccggcaatcgcctc
tcgaccgatccggtgcgctacgcccgcaacgccgaggccgcccgcgcggtcggggccggg
gcggtcggcgatccgaccatcgcctggctcgccgctgccttccgggcgatgcggcggctg
gcggacccggcactgatccggcggatccgcacgccctgcctgatcgtcgcggcgggcgcc
gacccggtctgcagcacgccggcggtcgagcgcttcgccgcccggctcaagaccgggcac
ctgatcgtgctgccgggcgcccgccacgagatcctgaccgagtgcgacgcggtccgcgcc
gatttctgggcggccttcgacgcgttcatccccggccatctcgtccattcggccgtcggc
gaagctgctcctcacgccaccgtcgccggctaa

DBGET integrated database retrieval system