KEGG   Meleagris gallopavo (turkey): 100539774Help
Entry
100539774         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 10-like
Orthology
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100539774
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100539774
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
13
AA seq 816 aa AA seqDB search
MTTVKTDGFTSGKVHEISVDLILGKYIFGEFSPDEFNQFFVTPRCSVELPPYNETVSCGI
KSTGEEYQRIEFGVNEVIETESSVLNNTDYSISSTLNPQAPEFILSCAPAQKTPDDSLGE
TNYNSIDCQFSDPTLTLDSGSNAENDGLSGGLGQRERKKKKKRPPGYYSYLEDVSDGMAP
TEALVNGHANSSGLNSIGTEDTELTGDIPSLATPRTCNSPDNSVDFIHEAVSNDSVSSAL
DNTRTAGQPEVCRVTNSEQFCIPSETGRDSPLRTAVVQPYAGTDTTESHGVTNGQTLESS
GEDTAANGVELHTVESTDSDQAKPEEASPTTEATATVAGSVPVNQPAKSWASLFHNSKPS
ASTSVVYVETKYTPPATSTLVPEKQVEVKEGPVPVSEDPVAIKIAELLENVKLVHKPVSL
QPRGLINKGNWCYINATLQALVACPPMYHLMKSIPMYSKSQRPCTSTPMIDSFVRLMNEF
TNMPVPPKAKQALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEEYLGFIL
NGLHEEMLTLKKLLSPHNEKLSVSNGPEVQTVHEEEEQDEQGEGSEDEWEQVGPRNKSSV
TRQADFVQTPITDIFGGHIRSVVYQQSSKESATLQPFFTLQLDIQSDKIRTVQDALESLV
ARESVQGYTTKTKQEVEISRRVTLEELPPVLVLHLKRFVYEKTGGCQKLIKNIEYPVDLE
ISKELLSPGVKSKIFKGQRTYRLFAAHHKFLFSQVVYHHGNSATGGHYTTDVFQIGLNGW
LRIDDQAVKVINQYQVVKPSAERTAYLLYYRRVDLL
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgtgaaaacagatggatttacctctggcaaagttcatgagatctctgtggac
cttattctggggaagtatatttttggggagttcagccctgatgaatttaatcagttcttt
gtgactccacgttgctctgttgagcttcccccttacaatgaaaccgtttcatgcggcatt
aagtccacaggggaggaatatcagagaattgaatttggtgttaatgaagttatcgaaacg
gaatcttctgtactaaataacaccgactacagtatttcaagcactctgaatcctcaggct
ccagaattcattctcagttgtgcacctgctcagaaaacccctgatgacagtctcggtgaa
acaaactacaactcaattgactgccagttctctgacccaaccctcactctggatagtggt
tctaatgctgaaaatgacggcttgtctggaggccttggacagagggagcgtaaaaagaag
aaaaaaagaccccctggatactacagttatttggaagatgtcagtgatggcatggctccc
acagaagctcttgtaaatggccacgcaaattcctcgggacttaacagtatcggcactgag
gatacggaactgacgggggacatcccctctctggccacaccaaggacttgcaacagcccg
gacaattctgtggacttcattcatgaagctgtttctaatgattctgtttctagcgcacta
gacaataccaggactgcagggcagcctgaggtatgcagggttactaattctgaacagttt
tgcatcccctcagagactggcagagatagccctttaaggacagctgttgtacagccttat
gctggtactgatactactgaaagtcatggcgttactaatggacaaacacttgaatcctct
ggtgaggacacagctgccaatggggtagaattgcacactgtggaaagcactgactcagac
caagctaagcctgaggaagcttcacctactactgaggcaacagccacggttgcaggatca
gtccctgttaatcagcctgcgaaatcgtgggctagtctttttcacaattccaagccctct
gcttccacatctgtggtctatgttgagactaagtatacccctcctgccacatctactctg
gtccctgaaaaacaggttgaagtcaaagaggggcctgttccagtttcagaggatcctgta
gccataaagattgcagaattactggaaaatgtaaaactagtacataaaccagtgtctttg
caacctcgagggctgatcaacaaaggaaactggtgctacatcaatgctaccctgcaagcc
ttggttgcttgccctccaatgtatcatttaatgaagtccattccaatgtattcaaaatca
caacggccgtgtacgtcaacaccaatgatagacagttttgttcgtttaatgaatgagttc
actaatatgcctgtacctcctaaagcaaaacaagctttaggtgataaaattgtgagggac
atccgaccaggagctgcctttgaacctacgtatatttacagacttctgacggttatcaag
tcaagtctgtcagagaagggcaggcaagaggatgctgaagaatacttgggatttattctc
aatggactacatgaagaaatgctgaccctaaagaaacttctctctccacataatgaaaaa
ctctctgtttccaatggccctgaggttcagactgttcatgaggaagaggagcaagatgag
caaggagaaggcagtgaggatgaatgggagcaagtgggacctcgcaacaaatcctcagtc
actcgacaggctgactttgttcagactccaataactgatatttttggtggtcacataaga
tctgttgtttaccagcagagttctaaagaatctgctacgctgcaacctttcttcaccctg
caactggatatccagtctgacaagatacgcaccgtccaggatgcattggaaagtttggtg
gcaagagagtctgtccagggctataccacaaaaaccaagcaagaggtggagatcagtcga
agagtgacactagaagaactcccccctgtccttgttttacacctcaagaggtttgtgtat
gagaagactggcggatgtcagaagcttatcaagaatattgagtatcctgttgatctggaa
attagtaaagagttactgtctcctggtgtgaaaagtaaaatttttaaaggccaaagaacc
taccggctctttgcagcacatcacaaattcctcttttcacaggttgtttatcatcacgga
aacagcgcaactggtggccattacactacggacgtcttccaaatcgggctcaacggctgg
ttacgcatcgatgaccaggcagtgaaggtgatcaatcagtaccaggtggtgaagccgtct
gcagaacgcacagcctacctcctgtactaccgccgagttgacctgctgtga

DBGET integrated database retrieval system