KEGG   Meleagris gallopavo (turkey): 100548808Help
Entry
100548808         CDS       T01523                                 

Definition
ubiquitin carboxyl-terminal hydrolase 12-like
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
mgp  Meleagris gallopavo (turkey)
Brite
Enzymes [BR:mgp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100548808
Peptidases [BR:mgp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100548808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
9
AA seq 414 aa AA seqDB search
MRGGTKPLVGARLYGSGGLKTWGNGVRSVNCFEFEMDNLKLKRECWHVLIPVLCSNQDSI
WGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKVQPR
KKESLLTCLSDLFNSIATQKKKVGVIPPKKFISRLRKENELFDNYMQQDAHEFLNYLLNT
IADLLQEEKKQEKQNGKLQNGSIESEEGDKTDLTWVHEIFQGTLTNETRCLNCEAVSSKD
EDFLDLSVDVEQNTSITHCLRGFSNTETLCSEYKYYCEQCRSKQEAQKRMRVKKLPMILA
LHLKRFKYMDQLHRYTKLSYRVVFPLELRLFNTSGDATNPDRMYDLVAVVVHCGSGPNRG
HYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYILFYQSRD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgaggggaggcaccaaacccctagtgggagctcggctgtacggtagtggtggactaaaa
acatggggaaatggggtgagatccgtcaactgctttgaatttgaaatggacaacttaaaa
ttgaaacgagaatgttggcatgttttaattcctgttctgtgcagtaaccaagactcaata
tggggcgccaatgcctcagctttggagaaagagattggtcctgaacagttccctgtgaat
gagcattactttggcttggtcaatttcggcaatacctgctactgcaactcagtcttgcag
gcactttatttttgtcgtccatttcgggaaaaagttctggcatacaaagtgcagcctcga
aagaaggaaagcctcctgacatgcctctctgatctcttcaacagtattgctacccaaaag
aagaaggtgggagtcatcccacccaagaaatttatttcccgattgaggaaagaaaatgaa
ttgtttgataattacatgcagcaggatgcacatgaattcctaaactacctacttaacact
attgctgacttgctacaagaagagaaaaagcaggagaagcagaatggcaaactccagaat
ggcagcattgaaagcgaagaaggagacaagactgatctgacgtgggtccatgaaatcttc
caaggaacactaaccaatgaaaccagatgtcttaattgtgaggctgttagtagcaaagat
gaggactttctggatctatcggttgatgtggaacaaaatacatcaattacacactgtctg
agagggtttagtaatactgaaactctgtgcagtgaatataagtactattgtgagcagtgc
cgcagtaaacaggaagcacagaagagaatgagagtgaagaagttgcccatgattctagct
ctgcacttaaaaaggttcaaatacatggaccagctgcatcgatacaccaaactctcctac
cgtgtcgtctttcccttggagctccggctttttaacacgtcaggagatgctacaaatcct
gacagaatgtatgaccttgtggctgtagttgttcactgtggcagcggtccaaatcgtggc
cattatatcaccattgtgaagagccatggcttttggttgctgtttgatgatgacattgta
gagaaaatcgatgctcaagccattgaagagttctatgggctaacatcagacatttccaaa
aactcagaatctggatatatcctcttctaccagtcaagagactaa

DBGET integrated database retrieval system