KEGG   Magnaporthe oryzae: MGG_01096Help
Entry
MGG_01096         CDS       T01027                                 

Definition
glucoamylase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
mgr  Magnaporthe oryzae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mgr00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 649 aa AA seqDB search
MDISRVDHGTSTSNITTSVNPVMHAISSFVLLGTYAVQAVLGRPNSLARRANVDSFIEVE
RPIALQGVLRNIGSDGALVRGAGPGVVIASPSTVDPDYFYTWTRDSALVLKCLTDIFANK
YDAGLQSTITQYITTQAQVQRIDNPSGPLSDGSGLGEPKYNANLSPYLGSWGRPQRDGPA
LRATALVAYANWLIGNNYTSTARDIVWPILRNDLNYVAQYWNRTGFDLWEEVQGSSFFTT
GAQYKALIEGDALAKKLGATCSSCESIAPNILCFLQSFWTPNGNYIVSNTNTGTNRSGKD
ANSILSSIHSFDPAAGCDELTFQPCSAKSLANHKAVVDSFRFYPINSGIQVGRGLAVGRY
SEDVYYGGNPWHLTTLAAAEQIYDAVYVWKKQGRLEVTSASLPFFRDLSSSIAVGSYASD
STTFTQIIDAALVYADGFIEVVQRYAGANGSLDEQIDKNNGSQRSARDLTWSYAAFLTAT
DRRAGVVPPSWFVPASLPGSCSTGSQQGVYSAVTPASFPASQTPITGAPPVPPTTTAPPG
GCTTAPVVAVTFNVLVTTTPGDTIKIVGDIEDLGKWNPQNGIALDANDYTASRPLWKKAI
TLKAGQVVQYKFINVASGGAVRWEADPNRVYTVPSSCATAVAVDGQWQT
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggacatctcacgagtcgatcatgggacctccacctccaacatcaccacctccgtcaat
cccgtcatgcacgccatctcatccttcgttctcctgggcacttatgctgtccaggctgtg
cttggtcgtcccaattcccttgcaagacgtgccaatgtcgactccttcattgaggtcgaa
cgcccaattgcccttcaaggagtcctccgcaacataggctcagatggcgccttggttcgt
ggtgccggtccaggtgtcgtcatcgcatctccgtccaccgtggacccggactacttttac
acctggacccgagacagcgcccttgtgctcaagtgcttgacggatattttcgccaacaag
tacgacgccgggctccagtcgaccatcacccagtacatcaccacccaggcccaggtgcaa
cgcatcgacaacccctccggacccctgagtgacggctcgggtctgggcgagcccaagtac
aatgccaacctctctccgtacctcggctcttggggaaggccgcagagggatgggcctgcg
ttgagggccactgccttggttgcctatgcaaactggctcatcgggaacaactacacgagc
actgcccgtgacatcgtgtggcctatcctgaggaatgacttgaactatgtggctcagtac
tggaacagaactgggtttgatctttgggaggaggttcaaggcagctcattcttcaccact
ggcgctcagtataaagccttgattgagggagacgctttggccaagaagcttggagcgact
tgctcatcctgcgagagcatcgcccctaatatcctctgcttcctgcagagcttctggact
ccgaatggcaactacatcgtctccaacaccaacacgggtactaaccgctccggcaaagac
gccaacagtattctatcatcgattcactcgttcgaccccgctgctggctgcgacgagctt
accttccagccctgcagtgcaaagtcccttgcaaatcacaaggccgtcgtcgactctttc
aggttctaccccatcaactctgggatccaagttggccgaggattggccgttggacgctac
tcggaagatgtctactacggtggcaacccatggcacctgacaacgctcgcggccgcagag
cagatctacgatgccgtctatgtgtggaaaaagcaaggccgtcttgaagttaccagcgca
tcactcccgtttttccgtgatctttcgtcatctattgccgtcggaagctacgcgtccgat
tcgacaacctttacccagatcatcgatgcagctctggtgtacgcagatggcttcatcgag
gtcgtgcagcgctatgctggcgccaatgggtctctggatgagcagatcgacaagaacaat
ggtagccagcgctcggcacgcgacctgacttggtcgtatgcagctttccttaccgccact
gatcgccgcgccggagttgttccgccatcgtggtttgtgccggccagccttcccggctcg
tgctctacaggctcacagcagggagtctactcggccgtgacgccagcctcgttcccagca
tctcagacgcccatcaccggcgcgccgcccgtcccccctactactacggcgcctccaggc
ggttgcacgacggcgcccgtagtagctgttactttcaacgtgctggtgacgacaacgccc
ggtgatactatcaagatcgtgggcgacattgaggacttgggcaagtggaacccgcagaac
ggcatcgccctggacgcgaacgactacactgccagcaggccgctgtggaagaaggccatc
actctcaaggcgggccaggttgtgcagtacaagttcatcaacgtggccagcggtggtgca
gtccgatgggaggctgatccgaaccgggtgtacacggtacccagctcgtgtgccactgct
gttgctgtagatggacagtggcagacgtag

DBGET integrated database retrieval system