KEGG   Magnaporthe oryzae: MGG_01096Help
Entry
MGG_01096         CDS       T01027                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
mgr  Magnaporthe oryzae
Pathway
mgr00500  Starch and sucrose metabolism
mgr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MGG_01096
Enzymes [BR:mgr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     MGG_01096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 2675098
NCBI-ProteinID: XP_003717838
UniProt: G4NCF7
Position
5
AA seq 649 aa AA seqDB search
MDISRVDHGTSTSNITTSVNPVMHAISSFVLLGTYAVQAVLGRPNSLARRANVDSFIEVE
RPIALQGVLRNIGSDGALVRGAGPGVVIASPSTVDPDYFYTWTRDSALVLKCLTDIFANK
YDAGLQSTITQYITTQAQVQRIDNPSGPLSDGSGLGEPKYNANLSPYLGSWGRPQRDGPA
LRATALVAYANWLIGNNYTSTARDIVWPILRNDLNYVAQYWNRTGFDLWEEVQGSSFFTT
GAQYKALIEGDALAKKLGATCSSCESIAPNILCFLQSFWTPNGNYIVSNTNTGTNRSGKD
ANSILSSIHSFDPAAGCDELTFQPCSAKSLANHKAVVDSFRFYPINSGIQVGRGLAVGRY
SEDVYYGGNPWHLTTLAAAEQIYDAVYVWKKQGRLEVTSASLPFFRDLSSSIAVGSYASD
STTFTQIIDAALVYADGFIEVVQRYAGANGSLDEQIDKNNGSQRSARDLTWSYAAFLTAT
DRRAGVVPPSWFVPASLPGSCSTGSQQGVYSAVTPASFPASQTPITGAPPVPPTTTAPPG
GCTTAPVVAVTFNVLVTTTPGDTIKIVGDIEDLGKWNPQNGIALDANDYTASRPLWKKAI
TLKAGQVVQYKFINVASGGAVRWEADPNRVYTVPSSCATAVAVDGQWQT
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggacatctcacgagtcgatcatgggacctccacctccaacatcaccacctccgtcaat
cccgtcatgcacgccatctcatccttcgttctcctgggcacttatgctgtccaggctgtg
cttggtcgtcccaattcccttgcaagacgtgccaatgtcgactccttcattgaggtcgaa
cgcccaattgcccttcaaggagtcctccgcaacataggctcagatggcgccttggttcgt
ggtgccggtccaggtgtcgtcatcgcatctccgtccaccgtggacccggactacttttac
acctggacccgagacagcgcccttgtgctcaagtgcttgacggatattttcgccaacaag
tacgacgccgggctccagtcgaccatcacccagtacatcaccacccaggcccaggtgcaa
cgcatcgacaacccctccggacccctgagtgacggctcgggtctgggcgagcccaagtac
aatgccaacctctctccgtacctcggctcttggggaaggccgcagagggatgggcctgcg
ttgagggccactgccttggttgcctatgcaaactggctcatcgggaacaactacacgagc
actgcccgtgacatcgtgtggcctatcctgaggaatgacttgaactatgtggctcagtac
tggaacagaactgggtttgatctttgggaggaggttcaaggcagctcattcttcaccact
ggcgctcagtataaagccttgattgagggagacgctttggccaagaagcttggagcgact
tgctcatcctgcgagagcatcgcccctaatatcctctgcttcctgcagagcttctggact
ccgaatggcaactacatcgtctccaacaccaacacgggtactaaccgctccggcaaagac
gccaacagtattctatcatcgattcactcgttcgaccccgctgctggctgcgacgagctt
accttccagccctgcagtgcaaagtcccttgcaaatcacaaggccgtcgtcgactctttc
aggttctaccccatcaactctgggatccaagttggccgaggattggccgttggacgctac
tcggaagatgtctactacggtggcaacccatggcacctgacaacgctcgcggccgcagag
cagatctacgatgccgtctatgtgtggaaaaagcaaggccgtcttgaagttaccagcgca
tcactcccgtttttccgtgatctttcgtcatctattgccgtcggaagctacgcgtccgat
tcgacaacctttacccagatcatcgatgcagctctggtgtacgcagatggcttcatcgag
gtcgtgcagcgctatgctggcgccaatgggtctctggatgagcagatcgacaagaacaat
ggtagccagcgctcggcacgcgacctgacttggtcgtatgcagctttccttaccgccact
gatcgccgcgccggagttgttccgccatcgtggtttgtgccggccagccttcccggctcg
tgctctacaggctcacagcagggagtctactcggccgtgacgccagcctcgttcccagca
tctcagacgcccatcaccggcgcgccgcccgtcccccctactactacggcgcctccaggc
ggttgcacgacggcgcccgtagtagctgttactttcaacgtgctggtgacgacaacgccc
ggtgatactatcaagatcgtgggcgacattgaggacttgggcaagtggaacccgcagaac
ggcatcgccctggacgcgaacgactacactgccagcaggccgctgtggaagaaggccatc
actctcaaggcgggccaggttgtgcagtacaagttcatcaacgtggccagcggtggtgca
gtccgatgggaggctgatccgaaccgggtgtacacggtacccagctcgtgtgccactgct
gttgctgtagatggacagtggcagacgtag

DBGET integrated database retrieval system