KEGG   Magnaporthe oryzae: MGG_01281Help
Entry
MGG_01281         CDS       T01027                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mgr  Magnaporthe oryzae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    MGG_01281
Enzymes [BR:mgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     MGG_01281
Exosome [BR:mgr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MGG_01281
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 577 aa AA seqDB search
MAASVSTCGIATPPSRPSRVPSTLGSKPSRMHDPDIIINALKDVVLPAVALSAQHVENAQ
VPSPDPEPEDMYIGSIDQGTTSSRFIIFNRAGEPVEAHQIEFENRYPNSGWHEHDPMELL
SSVEECIEEAMIKFTATRPGAKVHSVGITNQRETTVVWDTETGEPLYNAVVWPDTRTSPI
VHELRQKPGAEDLLDLCGLPLSTYPSSVKLMWLLRNVDTVKAAYDAGRLAFGTVDSWLIY
RLTGKSVHVTDGSNASRTMFMNLRSMSYDEKLLSFFEIDATKIRLPEIVPSAHPTAFGKF
ASGPLKDVRIAGCLGDQSSALVGQRAFASGQAKNTYGTGCFLLYNVGPEPVISKAGLLAT
VAYDFGEELGGRAYALEGSIAVAGSGVKFLSNNLGFAPSSGEITDLAGSVDDNGGVVFVT
AFSGLFAPYWIDDAKGTLFGLTQHTQKGHIARATLEATCYQTKAILDAMERDSGRKLERL
AVDGGMSNSDLCMQTQADVGNIPVDRPEMRETTALGAAIAAGLATGVWKNISEVLEVGGR
NRSQFLPSPDRAKAQRMFKKWEQAVEMSRGWLREGEE
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatcagtctcaacctgtggcatcgccacgcccccttcaagaccctcaagagta
cccagcactctgggctcaaaaccttcgcgtatgcatgatccagatatcatcatcaacgca
ctcaaggacgttgtcctaccggctgttgccttgtcggcacagcacgtggagaatgcccaa
gtcccatcccctgacccggagccagaagacatgtacatcggctcaatagaccagggtacc
acgtcttcgcgcttcatcatcttcaaccgtgccggcgagcccgtcgaggcgcaccagatt
gagtttgagaaccgctatccaaactcgggctggcacgagcatgacccaatggagttgctc
tccagcgttgaggagtgcatagaagaggccatgatcaagttcaccgcgacgaggccaggt
gccaaggttcactcggttggcatcacaaaccagagggaaacgacggtggtctgggatacg
gagacgggcgagccgctgtacaacgctgtagtgtggcccgacacccgcacctcgcccatc
gttcatgaactgcggcaaaagccgggtgcagaggatctgctggacctgtgcggcttgcct
ctgtcaacctacccgtcctctgtcaagctcatgtggttattgcggaacgtagacaccgtc
aaggctgcttatgacgccggccgactcgcctttggcacggttgactcgtggctcatctac
cgtctgactggtaaatcggtgcacgtaactgatggttccaacgccagccgcaccatgttt
atgaacctgcgcagcatgtcctatgacgaaaagctgctgtcgttcttcgagattgacgcc
accaagatccgcctccctgagattgtgccctcggcacaccccactgcctttggaaaattt
gcctcgggtcccctcaaggacgtcaggatagcaggctgcctgggcgaccagtccagcgcc
ctggtgggccagcgcgccttcgcctcgggccaggccaagaacacttacggcacgggctgc
ttcctgctgtataacgtcggcccggagcccgtcatctcaaaggctggcctgctggccacg
gtagcctacgactttggcgaggagctgggcggccgcgcctacgccctcgagggcagcatc
gccgttgccggcagtggcgttaagttcctgtccaacaacctgggcttcgcaccgagcagc
ggcgagattacggatctggccggcagcgtcgacgacaacggcggcgtggtctttgtgact
gctttcagtggcctctttgcgccttactggatcgacgatgccaagggaacactctttgga
ctcacgcagcacacacaaaagggccacatcgcgcgcgcaactctcgaggcgacgtgctac
cagaccaaggcgatcctggacgccatggaacgtgacagcgggcgcaagcttgagcgcctg
gccgtcgacggcggcatgtccaactcggacctgtgcatgcagacccaggccgacgtcggc
aacatccccgttgaccggcccgagatgcgcgagaccacggccctgggcgccgccatcgcc
gccggcttggccacgggcgtatggaagaacatctcagaggtcctcgaggtcggcggccgc
aataggtcccagttcctaccgtctcccgatcgcgccaaggctcaaaggatgttcaagaag
tgggagcaggccgtcgagatgagtagggggtggttgagggaaggtgaagaataa

DBGET integrated database retrieval system