KEGG   Magnaporthe oryzae: MGG_09924Help
Entry
MGG_09924         CDS       T01027                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mgr  Magnaporthe oryzae
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mgr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MGG_09924
Enzymes [BR:mgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     MGG_09924
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 695 aa AA seqDB search
MLSRIGATAAHAPAKVELCLRAAPPCLASSSSSSRRGPKSHHIGHRSNGFVVWTARRGYA
SSRSVITKDKPDSKIAVLGGGLTGLSTALFLSVFAPRASITLYEANERLGGWVHTVDSEA
EDSQGRPHSVRFERGPRVVQLKEGDANSRLYVLLLHQLGIADQAWALGQDSELARRYIYH
PDHLIDLTGPSNSDNRLIKAVSLARFAGRMLKNALTEPALKGLLPALAHMLSNRKPLGAE
EYCRCLVDSEDESIGSCLTRIFGGRSSVADNLASAMTHGIYGGDIWKLSIQSTLFARAQM
FPYRLDVPKASRASSFSVERLSDLNMMTFVTKASSKDSVVTGQRLLGGYTGFYGGMEALT
EALVQALRKRSNVTIETGSLVADVAPSSNKLVEVKTAKSTATFDKVISTLFSRQLASITG
GRVPALGEKKGASMHVVNIWFPRSGLNHPHHGFGYLISSQADVERGLLGVLFDSDREGAI
WRESEQREQGEKVSSLVARQQPPTGTKLTVLLRVPSEDEPSRTPEQAEVIALAHVRRQFG
IAADEPVHTQVSTARDCIPQHEVGHQESLAAAHAQLESAFGGRLAVAGPSYTAPGILPSI
RAAFDVAASCTGLDAAYRGLAPSAADHAPAEFSLVSDPTVGATGLGRFADGRRSMWDDLA
IVDGAVKADFVGLKKESLQRVIVPRLQFGSFSKSS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccaggatcggcgcgacagcggcccacgcgcctgcgaaggtggagctgtgtctc
cgcgccgcgccgccgtgcctcgcatcatcatcatcatcatcacgaagggggccgaaaagc
catcatatcggccacagaagcaatgggttcgttgtctggaccgcacggcggggctacgcc
agcagcagaagcgtcatcacaaaggacaagcccgactcaaagatcgcggtgctcggcggt
gggctgacggggctatccacggccctgttcctctccgtctttgcacccagggccagcatc
acgctgtacgaggccaacgagcgcctgggcggctgggtgcacacggtcgactccgaggcc
gaggactcacaggggaggccgcatagcgtacggttcgaacgagggccgagggtggtgcag
ctcaaggagggcgatgcaaactctcgcctctatgtgttgttgcttcatcaactgggcata
gcagaccaggcgtgggctttgggccaagattcggaactggcgcgccgctacatctaccac
ccagaccatcttatcgatctcaccggcccttcgaacagtgacaaccgcctcatcaaagct
gtttcattggctcgcttcgccggtaggatgcttaaaaacgcactgacggaaccagcgctc
aagggcctgctgccagccctcgcccacatgctctccaacagaaagccgctgggggccgag
gagtactgccggtgcctcgtcgacagcgaggacgagtcgataggcagctgcctgacgcgg
atatttggcggacgcagcagcgtggccgacaacctggcctcggccatgacgcacggcatc
tacggcggcgatatttggaagctgagcatccagtcgacgctgtttgcgagggcgcagatg
tttccctaccgcctcgacgtgcccaaggcgtcgagagcttctagcttttccgtggagagg
ctcagcgacctgaacatgatgacatttgtcaccaaggcctcgtccaaggactctgtggtg
actggtcagaggctcctgggcggctacacgggcttctacggcggcatggaggcgctcaca
gaggcgttagtgcaggctttgcgcaagcggagcaatgttacgatagagacgggcagcttg
gtggctgatgtagcgccgtcgtcaaataaacttgtagaggtcaaaacagccaagtcaacg
gcaacttttgacaaggtcatatcgaccttgttcagccggcagctggcttctattacaggc
ggacgcgttcccgccctcggcgagaaaaagggtgcgtccatgcatgtagtcaacatctgg
ttcccgagatccggcctgaaccatccgcaccacggctttggctaccttatatcatcccaa
gccgacgtcgaacggggtctgcttggtgtcctcttcgactctgaccgcgaaggagccatc
tggcgggaatcagaacaacgggaacagggcgaaaaggtctcatccttggtcgcccgccag
caacccccaaccggcaccaagctgacggttctcctgcgcgtgccctcggaggacgagcca
tcacggactcccgaacaggccgaagtcatcgccctcgcccacgtccggcggcagttcggc
atcgctgccgacgaacccgtccacacccaggttagcactgcgcgcgactgcatcccgcag
cacgaggtcggccaccaggagagcctggcagccgcgcacgcccagctcgagtccgccttt
gggggccgcctcgctgtcgcgggcccctcgtacaccgcaccgggcatcctgccctccatc
cgcgccgcctttgacgtcgccgccagctgcaccggactcgatgccgcctaccgcggcctg
gccccgtctgctgccgaccacgcgccggccgagttttccctcgtttccgacccgaccgtg
ggtgccacgggactgggccgcttcgccgacggcaggaggtccatgtgggatgacctcgca
atagtcgatggcgcggtcaaggcggactttgtgggcctgaagaaggagtctctgcagcgc
gtaatcgtgccccggctgcagtttggtagcttttccaagtcctcgtag

DBGET integrated database retrieval system