KEGG   Mycoplasma gallisepticum VA94_7994-1-7P: HFMG94VAA_3665Help
Entry
HFMG94VAA_3665    CDS       T02203                                 

Gene name
pfkA
Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
mgv  Mycoplasma gallisepticum VA94_7994-1-7P
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:mgv01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mgv01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mgv00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mgv00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mgv00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism
Metabolism; Energy metabolism; Methane metabolism [PATH:mgv00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(621644..622642)
Genome map
AA seq 332 aa AA seqDB search
MAIQTQRIAILTSGGDSPGMNPAIYGLVQQAIINNIQPYLVYEGYKGLVEDQIVLANQQE
VIDHFFDSGTFIYSARLVEFKDLEVRKKAVSNLKAKKIDTLVVIGGDGSYQGAKLLSEMG
INVIAMPGTIDNDVSSSDYTIGFYSALEHITRTIQEIISTSVSHNRVSISEVMGRHCGDL
AVYAALATKADLVITPENIKTTQEIVDLAAKRMLQDHKRTFTVIVCEHIYGEDGRDSLKT
IAQQINDQLGIKTNLNILTYGQRGQVPTPMERILAMKFAIKAFECINEQRYGVVLGLSGD
EIVAYNFQEALNKRNPSRIKLINLSNRINGGF
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggccattcaaacacaacgaattgcgatcttaacttctggaggagattctccaggaatg
aatccagcaatttatgggttagttcaacaagcaatcattaataatattcaaccttactta
gtttatgaaggttataaaggcttagttgaagatcagatcgttcttgctaaccaacaagaa
gtgatcgaccatttctttgattcgggaacgtttatttattcagcaagattagttgaattc
aaagatcttgaagtaagaaaaaaagcagtaagtaaccttaaagcaaaaaaaatcgatacg
ttagtagtgatcggtggtgatggttcatatcaaggcgcaaaactattatctgagatgggg
attaatgtgattgcgatgcctggaacgattgataatgatgtatcttcatcagattacaca
atcggtttttattcagcattagaacatattactagaacgattcaagagatcatctcaact
agtgtttctcacaaccgggtatcgatctctgaagtgatgggacgccattgtggggattta
gctgtttatgcagcacttgcaactaaagctgatctagtaattaccccagaaaatatcaaa
acaacccaagagatcgtagatcttgctgctaaaagaatgttacaagatcacaaacgcacg
tttactgtgatcgtttgtgaacatatttatggtgaagatggcagggatagtttaaaaacg
atcgcccaacagattaatgatcagttaggaattaaaactaatcttaatatcttaacctac
ggtcaacgtggtcaagttcccacaccgatggaacggattctagccatgaaatttgcgatc
aaagcgtttgaatgtattaacgaacaaagatacggcgttgttttaggtttaagcggtgat
gagatcgtagcttacaatttccaagaagcattaaataaacgtaatccttcaagaatcaaa
ttaattaatttaagcaatagaataaacggtggtttttaa

DBGET integrated database retrieval system