KEGG   Marinithermus hydrothermalis: Marky_1887Help
Entry
Marky_1887        CDS       T01457                                 

Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
mhd  Marinithermus hydrothermalis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mhd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Marky_1887
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Marky_1887
Enzymes [BR:mhd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Marky_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1893336..1894502
Genome map
AA seq 388 aa AA seqDB search
MATAPLDPQARHALFTQARRVVVKVGSAALAGEAGLNPERIDRLAAELAALGQAGREVIL
VSSGAIAAGTRKIGLPRRPASIPEKQAAAAVGQSALVQAWEDAFRKHGRSVAQLLLTADD
LAHRHRYLNARNTLNTLLAWGVVPLINENDTVMVDEIQFGDNDHLATLIAGLVGADLLVI
LSDVDALYDADPRQNPAARPIRWVPRVDGRLLRAAGEAPSAVGRGGMRSKLLAAKKCLDA
GIPLLLASGRQPGVLEAAFAGLEVGTLFWSGERRYSGKKLWLAQLPRPQGEVVVDAGAAR
ALRTAGTSLLPVGVRAVRGVFGVGAPVRVVDEDGRLVGIGLTQYAAADLERIKGRRTHEI
AAVLGHNPSDEVIHRDNFALAEELVDAE
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcgaccgctccgctcgaccctcaagcccgccacgccctcttcacccaggcccggcgc
gtcgtggtgaaggtcggcagcgccgcgctggcgggggaggcggggctgaacccggaacgc
atcgaccggctcgccgccgagctcgccgccctcggccaagccgggcgcgaggtgatcctg
gtctcctccggcgcgatcgccgccggcacccggaagatcggcctgccccggcggcccgcc
tccatccccgaaaagcaggccgcggccgcggtggggcaaagcgctctggtccaggcctgg
gaggacgcgttccgtaagcacggccgctccgtggcgcaactcctcctcaccgccgacgac
ctcgcccaccgccaccgctacctgaacgcgcgcaacacgctcaacaccctcctcgcctgg
ggggtggtgcccctcatcaacgagaacgacaccgtgatggtggacgagatccagttcggc
gacaacgaccacctcgccaccctcatcgcgggcctcgtgggcgcggacctcctcgtcatc
ctctccgacgtggacgcgctctacgacgcggacccgcgccaaaaccccgcggcccgcccc
atccgctgggtgccccgggtggacggccggctgctgcgcgccgcgggtgaggccccgagc
gcggtggggcggggcgggatgcgcagcaagctcctcgcggccaagaagtgcctcgacgcg
gggatccccctcctcctggcctccggtcgccagccgggggtcctcgaggcggccttcgcc
ggcctcgaggtcggcaccctgttctggagcggcgaacgccggtacagtgggaagaagctc
tggctcgcccagctcccccgcccccaaggtgaggtggtggtggacgcgggcgcggcgcgg
gccctgcgcaccgcgggcacctccctcctgccggtgggggtgcgggcggtgcgcggcgtg
ttcggggtgggcgccccggtccgggtggtggacgaggacggccggctcgtggggatcggg
ctcacccagtacgccgcggccgacctggagcggatcaagggccgccgcacccacgagatc
gcggcggtcctcgggcacaacccctcggacgaggtgatccaccgcgacaacttcgccctc
gccgaggagctggtggacgcggagtaa

DBGET integrated database retrieval system