KEGG   Mycoplasma hyopneumoniae 232: mhp515Help
Entry
mhp515            CDS       T00206                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    mhp515 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp515 (glcK)
   00052 Galactose metabolism
    mhp515 (glcK)
   00500 Starch and sucrose metabolism
    mhp515 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    mhp515 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mhp515 (glcK)
   00524 Butirosin and neomycin biosynthesis
    mhp515 (glcK)
Enzymes [BR:mhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     mhp515 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647525..648418
Genome map
AA seq 297 aa AA seqDB search
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVIDYKKILDKILDLVSKYKINAIAL
CIPGPADYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
KKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYKQIVGDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatataattttgccactatcgacatcggcggaacaaatactcgttttgcaatt
tttagtgataataaaatcacaaaaaaaattaaatttgccactgatgttatagattataaa
aaaattcttgataaaattcttgatctagttagcaaatacaagattaacgcaatcgccttg
tgcatccctggtccggctgattatcaaaaagggattattctctcttcgcctaatttaata
ggctgaaatggaataaatattaaggaatatctcctaaataattctaaattagaatatgct
atctttgaaaatgatgcaaatgcaatggcatttgccaatcatattttttataaaaatacc
aaaaaaggcgtaactcagttttatacaatctcaactggttttggtgctggactcgtaatt
aataataaaatttttcatggtgctaatggttttggacaggaaattgcacatattccaacc
tcaaaaatatttaataaaaagcatcatctaaataattatgcagctgaattatttatctcg
ggaacaggaatgtctttaagagctaaagataaaaacttagaacaaaccgaaccaaaaaat
attatcgcactatctcaagaagataaaggctacaaacaaattgttggcgactgtattgat
accttggcgcgaacaatttcgataacaattggaattttaaatcctaatttgatggttttt
ggcggttctatagctgagtataatttttgaataattcaaaaagcgatcaaaaaagcgaaa
cagtgaacaaataaagaccaatgagaagctataaagtttgaaaaagatccttttggtgat
gattcggctttatttgggctttactacctaatattagaaaaaacaaagaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system