KEGG   Mycoplasma hyopneumoniae 232: mhp515Help
Entry
mhp515            CDS       T00206                                 

Gene name
glcK
Definition
(GenBank) glucose kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mhy  Mycoplasma hyopneumoniae 232
Pathway
mhy00010  Glycolysis / Gluconeogenesis
mhy00052  Galactose metabolism
mhy00500  Starch and sucrose metabolism
mhy00520  Amino sugar and nucleotide sugar metabolism
mhy00521  Streptomycin biosynthesis
mhy01100  Metabolic pathways
mhy01110  Biosynthesis of secondary metabolites
mhy01120  Microbial metabolism in diverse environments
mhy01130  Biosynthesis of antibiotics
mhy01200  Carbon metabolism
Module
mhy_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mhy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    mhp515 (glcK)
   00052 Galactose metabolism
    mhp515 (glcK)
   00500 Starch and sucrose metabolism
    mhp515 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    mhp515 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    mhp515 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    mhp515 (glcK)
Enzymes [BR:mhy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     mhp515 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase Hydant_A_N FtsA
Motif
Other DBs
NCBI-ProteinID: AAV27601
UniProt: Q600E0
Position
647525..648418
Genome map
AA seq 297 aa AA seqDB search
MIKYNFATIDIGGTNTRFAIFSDNKITKKIKFATDVIDYKKILDKILDLVSKYKINAIAL
CIPGPADYQKGIILSSPNLIGWNGINIKEYLLNNSKLEYAIFENDANAMAFANHIFYKNT
KKGVTQFYTISTGFGAGLVINNKIFHGANGFGQEIAHIPTSKIFNKKHHLNNYAAELFIS
GTGMSLRAKDKNLEQTEPKNIIALSQEDKGYKQIVGDCIDTLARTISITIGILNPNLMVF
GGSIAEYNFWIIQKAIKKAKQWTNKDQWEAIKFEKDPFGDDSALFGLYYLILEKTKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgataaaatataattttgccactatcgacatcggcggaacaaatactcgttttgcaatt
tttagtgataataaaatcacaaaaaaaattaaatttgccactgatgttatagattataaa
aaaattcttgataaaattcttgatctagttagcaaatacaagattaacgcaatcgccttg
tgcatccctggtccggctgattatcaaaaagggattattctctcttcgcctaatttaata
ggctgaaatggaataaatattaaggaatatctcctaaataattctaaattagaatatgct
atctttgaaaatgatgcaaatgcaatggcatttgccaatcatattttttataaaaatacc
aaaaaaggcgtaactcagttttatacaatctcaactggttttggtgctggactcgtaatt
aataataaaatttttcatggtgctaatggttttggacaggaaattgcacatattccaacc
tcaaaaatatttaataaaaagcatcatctaaataattatgcagctgaattatttatctcg
ggaacaggaatgtctttaagagctaaagataaaaacttagaacaaaccgaaccaaaaaat
attatcgcactatctcaagaagataaaggctacaaacaaattgttggcgactgtattgat
accttggcgcgaacaatttcgataacaattggaattttaaatcctaatttgatggttttt
ggcggttctatagctgagtataatttttgaataattcaaaaagcgatcaaaaaagcgaaa
cagtgaacaaataaagaccaatgagaagctataaagtttgaaaaagatccttttggtgat
gattcggctttatttgggctttactacctaatattagaaaaaacaaagaaataa

DBGET integrated database retrieval system