KEGG   Mycobacterium intracellulare ATCC 13950: OCU_29790Help
Entry
OCU_29790         CDS       T02158                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:mia00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    OCU_29790
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    OCU_29790
Enzymes [BR:mia01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     OCU_29790
Two-component system [BR:mia02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   OCU_29790
Bacterial motility proteins [BR:mia02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    OCU_29790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168969..3169565
Genome map
AA seq 198 aa AA seqDB search
MVLVASLGGMKALGTVLAGLPGDFAVPVVVAQHRRPTLSGDDPLAQILSRASSLPIRVAE
PGASADKPGITIVPAGRTATIDADGAWMLAEEASKASVGDAVLTSSAALVPTVAVILTGR
LADGANGCRAVKRNGGRVLVQDPATAEASSMPAHAIATGCVDFVLPPDRLAAAVLALTTA
PGGAEPLTVPVPPWACLN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctggtggcgtcgctgggcggcatgaaagccctgggcaccgtgctcgcgggtctg
ccgggtgattttgcggtacccgtcgtcgtcgcccagcatcgccgccccacgctcagcggc
gacgatccgctggcccagattttgtcccgcgcgagctctctgccgattcgagtcgccgag
ccgggggcgtcggcggacaaaccgggcatcaccatcgtgcccgccggaaggacggcaacc
atcgatgcggacggcgcctggatgctcgccgaggaagcgtccaaggccagcgtcggggac
gccgtcctgaccagctccgccgcgctggtgccgactgtcgccgtgatcctgaccgggcgg
ctggccgacggcgccaacggatgtcgcgcggtcaagcgcaacggcgggcgcgtgctcgtc
caagacccggcgacggccgaggcgtcgagcatgccggcgcacgcgatcgccaccggctgc
gtggatttcgtgctgccgcccgatcgcctcgcggcggcggtgctggccctgaccaccgca
cccgggggcgccgaaccgctgacggtgcccgtgccgccgtgggcatgtcttaactag

DBGET integrated database retrieval system