KEGG   Mycobacterium intracellulare ATCC 13950: OCU_29790Help
Entry
OCU_29790         CDS       T02158                                 

Definition
CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mia  Mycobacterium intracellulare ATCC 13950
Pathway
Two-component system
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mia02020]
Cellular Processes; Cell motility; Bacterial chemotaxis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3168969..3169565
Genome map
AA seq 198 aa AA seqDB search
MVLVASLGGMKALGTVLAGLPGDFAVPVVVAQHRRPTLSGDDPLAQILSRASSLPIRVAE
PGASADKPGITIVPAGRTATIDADGAWMLAEEASKASVGDAVLTSSAALVPTVAVILTGR
LADGANGCRAVKRNGGRVLVQDPATAEASSMPAHAIATGCVDFVLPPDRLAAAVLALTTA
PGGAEPLTVPVPPWACLN
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
gtggtgctggtggcgtcgctgggcggcatgaaagccctgggcaccgtgctcgcgggtctg
ccgggtgattttgcggtacccgtcgtcgtcgcccagcatcgccgccccacgctcagcggc
gacgatccgctggcccagattttgtcccgcgcgagctctctgccgattcgagtcgccgag
ccgggggcgtcggcggacaaaccgggcatcaccatcgtgcccgccggaaggacggcaacc
atcgatgcggacggcgcctggatgctcgccgaggaagcgtccaaggccagcgtcggggac
gccgtcctgaccagctccgccgcgctggtgccgactgtcgccgtgatcctgaccgggcgg
ctggccgacggcgccaacggatgtcgcgcggtcaagcgcaacggcgggcgcgtgctcgtc
caagacccggcgacggccgaggcgtcgagcatgccggcgcacgcgatcgccaccggctgc
gtggatttcgtgctgccgcccgatcgcctcgcggcggcggtgctggccctgaccaccgca
cccgggggcgccgaaccgctgacggtgcccgtgccgccgtgggcatgtcttaactag

DBGET integrated database retrieval system