KEGG   Mycobacterium indicus pranii: MIP_04475Help
Entry
MIP_04475         CDS       T02325                                 

Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
mid  Mycobacterium indicus pranii
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mid01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mid00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3310144..3311547)
Genome map
AA seq 467 aa AA seqDB search
MDSVSTTRPSPMARIDLRGAELTAARLRAALPRGGADVEAVLPTVRPIVQAVAERGAEAA
LEFGASFDGVRPPAVRVPEAALEKALADLDAAVADALRVMIDRTRAVHADQRRTDVTTTL
GPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLVVASPPQAQFDGLP
HPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRARSASSPEAVAELA
PVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADNTADPAHVAADMISQAEHDE
MAGSVLVTPSEDLAAATDRELAAQLQTTVHRERVTAALGGRQSAIILVDDVDAGVKVVNA
YAAEHLEIQTADAASVAGRIRAAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVITLAEAEDLPAHGEAVRRRFER
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgtgagcaccacccgaccgtcgccgatggcccgtatcgacctgcggggcgcg
gagttgacggctgcccgattgcgggcggcgctgccgcgcggcggcgccgacgtggaggcg
gtgctgcccaccgtgcgcccgatcgtgcaggccgtcgcggagcgcggggccgaagccgct
ctggaattcggggcctccttcgacggcgtgcggccgccggccgtccgggtgcccgaggcg
gccctcgagaaggccctggccgacctggacgcggcggtcgccgacgccctgcgggtgatg
atcgaccgcacccgcgccgtgcacgcggaccagcgccgcaccgacgtcacgacgacactc
ggcccgggcgcgacggtcaccgaacggtgggtaccggtcgagcgggtgggcctgtacgtg
cccggcggcaacgccgtgtacccgtccagcgtcgtgatgaacgtcgtgccggcgcaggcc
gccggggtcgcgtcgctggtggtggccagcccgccgcaggcccagttcgacgggctgccg
cacccgacgatcctggccgcggcccggctgctgggcgtcgacgaggtgtgggccgtcggc
ggcgcgcaggcggtggcgctgctggcctacggcggcaccgataccggggccgaatggccc
ggcttctcctcggatcgcgcacgatccgcatcgtcgccggaggcagtcgccgagctggcg
cccgtcgacatgatcaccgggcccggcaacatctacgtcaccgccgccaagcggctgtgc
cggtcgcgggtcggcatcgacgccgaggccgggccgacggagatcgcaatcctggccgac
aacaccgccgaccccgcgcacgtggccgccgacatgatcagccaggccgaacacgacgag
atggccggcagcgtgctggtgacccccagcgaagacctggccgcggccaccgaccgggaa
ctggccgcccagttgcagacgaccgtgcaccgtgagcgggtgaccgccgcgctgggtggg
cgtcaatcggcgatcatcctggtcgacgacgtcgacgccggcgtcaaggtggtcaacgcc
tacgccgccgaacacctggagatccagaccgccgacgcggcgagcgtggccgggcggata
cgcgcggcgggagccattttcgtcggcccgtacgcgccggtgagcctcggggactactgc
gccggttccaatcacgtcctgccgaccgcgggctgcgcgcggcattccagcggactgtcc
gtgcagaccttcctgcggggcatccacgtcgtcgactacaccgaggcggccctgaaagac
gtgtcggggcatgtgatcacactcgccgaggccgaggacctgccggcgcacggcgaggcg
gtacggcggaggttcgagcgatga

DBGET integrated database retrieval system