KEGG   Mycobacterium intracellulare subsp. intracellulare: MIP_04475Help
Entry
MIP_04475         CDS       T02325                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mid  Mycobacterium intracellulare subsp. intracellulare
Pathway
mid00340  Histidine metabolism
mid01100  Metabolic pathways
mid01110  Biosynthesis of secondary metabolites
mid01230  Biosynthesis of amino acids
Module
mid_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:mid00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MIP_04475
Enzymes [BR:mid01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MIP_04475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: AFS15045
UniProt: J9WDF6
Position
complement(3310144..3311547)
Genome map
AA seq 467 aa AA seqDB search
MDSVSTTRPSPMARIDLRGAELTAARLRAALPRGGADVEAVLPTVRPIVQAVAERGAEAA
LEFGASFDGVRPPAVRVPEAALEKALADLDAAVADALRVMIDRTRAVHADQRRTDVTTTL
GPGATVTERWVPVERVGLYVPGGNAVYPSSVVMNVVPAQAAGVASLVVASPPQAQFDGLP
HPTILAAARLLGVDEVWAVGGAQAVALLAYGGTDTGAEWPGFSSDRARSASSPEAVAELA
PVDMITGPGNIYVTAAKRLCRSRVGIDAEAGPTEIAILADNTADPAHVAADMISQAEHDE
MAGSVLVTPSEDLAAATDRELAAQLQTTVHRERVTAALGGRQSAIILVDDVDAGVKVVNA
YAAEHLEIQTADAASVAGRIRAAGAIFVGPYAPVSLGDYCAGSNHVLPTAGCARHSSGLS
VQTFLRGIHVVDYTEAALKDVSGHVITLAEAEDLPAHGEAVRRRFER
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atggacagcgtgagcaccacccgaccgtcgccgatggcccgtatcgacctgcggggcgcg
gagttgacggctgcccgattgcgggcggcgctgccgcgcggcggcgccgacgtggaggcg
gtgctgcccaccgtgcgcccgatcgtgcaggccgtcgcggagcgcggggccgaagccgct
ctggaattcggggcctccttcgacggcgtgcggccgccggccgtccgggtgcccgaggcg
gccctcgagaaggccctggccgacctggacgcggcggtcgccgacgccctgcgggtgatg
atcgaccgcacccgcgccgtgcacgcggaccagcgccgcaccgacgtcacgacgacactc
ggcccgggcgcgacggtcaccgaacggtgggtaccggtcgagcgggtgggcctgtacgtg
cccggcggcaacgccgtgtacccgtccagcgtcgtgatgaacgtcgtgccggcgcaggcc
gccggggtcgcgtcgctggtggtggccagcccgccgcaggcccagttcgacgggctgccg
cacccgacgatcctggccgcggcccggctgctgggcgtcgacgaggtgtgggccgtcggc
ggcgcgcaggcggtggcgctgctggcctacggcggcaccgataccggggccgaatggccc
ggcttctcctcggatcgcgcacgatccgcatcgtcgccggaggcagtcgccgagctggcg
cccgtcgacatgatcaccgggcccggcaacatctacgtcaccgccgccaagcggctgtgc
cggtcgcgggtcggcatcgacgccgaggccgggccgacggagatcgcaatcctggccgac
aacaccgccgaccccgcgcacgtggccgccgacatgatcagccaggccgaacacgacgag
atggccggcagcgtgctggtgacccccagcgaagacctggccgcggccaccgaccgggaa
ctggccgcccagttgcagacgaccgtgcaccgtgagcgggtgaccgccgcgctgggtggg
cgtcaatcggcgatcatcctggtcgacgacgtcgacgccggcgtcaaggtggtcaacgcc
tacgccgccgaacacctggagatccagaccgccgacgcggcgagcgtggccgggcggata
cgcgcggcgggagccattttcgtcggcccgtacgcgccggtgagcctcggggactactgc
gccggttccaatcacgtcctgccgaccgcgggctgcgcgcggcattccagcggactgtcc
gtgcagaccttcctgcggggcatccacgtcgtcgactacaccgaggcggccctgaaagac
gtgtcggggcatgtgatcacactcgccgaggccgaggacctgccggcgcacggcgaggcg
gtacggcggaggttcgagcgatga

DBGET integrated database retrieval system