KEGG   Methanotorris igneus: Metig_0394Help
Entry
Metig_0394        CDS       T01510                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mig  Methanotorris igneus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mig01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:mig00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(409813..410619)
Genome map
AA seq 268 aa AA seqDB search
MNVLDKIVKDTRKRIELERGRNILRELENFIKDRELDEYIEKHSKLKLSKSIKKAKETRN
PIITEIKPSSPSKGNIRRIKEEDIENIARDMVEGGCCGISILTEPKYFNGSYRNLIIARK
FKVPILFKDFVVDFYQIDIAKTIGANIVLLMVSVLGEDIGEFLDYAHENDLECLVETHSE
EEIDIALDSNAKIIGINNRDLKTLNIDLKTTEKLAPLIPNKKIKISESGIYTRDDLMYVL
KYTNCALIGSSIMESGNIKEKVEELSRK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttttagataaaattgtaaaggatacaaggaaaagaatagaattagaaagagga
aggaatatattgagagaattggaaaattttatcaaagatcgtgaacttgatgagtatatt
gaaaaacatagcaaattaaaactatcaaaaagtataaaaaaagcgaaagaaacaagaaat
ccaataattacagaaattaaaccatcatcaccatcaaaaggaaatatcagaagaattaaa
gaggaagatattgaaaatatagcaagagatatggttgagggcggatgttgtggaatttcc
atcctaactgagccaaaatattttaatggaagttatagaaatttgattatagcaaggaaa
tttaaagttccaatactcttcaaggattttgttgttgatttttatcagatcgacatagca
aaaaccattggagcaaatatagtgttgttgatggtttctgttttaggggaagatattgga
gagttcttggattatgctcatgagaatgatttggagtgtttagttgaaacacatagcgag
gaagaaattgatattgcattagacagtaatgcaaagattattggcataaataatagggat
ttaaaaacactcaatattgatttaaaaaccacggaaaaattagctccattaataccaaat
aaaaagataaaaataagtgaaagtgggatttatacaagagacgatttaatgtatgttcta
aaatatactaactgtgctttaattggctcatcaataatggaaagtggaaatataaaagag
aaagttgaagaattatcaagaaaatag

DBGET integrated database retrieval system