KEGG   Mycobacterium sp. JLS: Mjls_2628Help
Entry
Mjls_2628         CDS       T00482                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mjl  Mycobacterium sp. JLS
Pathway
mjl00260  Glycine, serine and threonine metabolism
mjl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mjl01100  Metabolic pathways
mjl01110  Biosynthesis of secondary metabolites
mjl01130  Biosynthesis of antibiotics
mjl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_2628
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mjls_2628
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mjls_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABN98409
JGI: mjls2628
Position
2750704..2752005
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVEVPTHWYNLAAELGEPIPPHLHPGTKEPVSPDDLAPLFASGLIAQ
EASTETYIEIPQAVREIYTMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGVQFGLEIEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTEAGRAILAKDPHTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPNGADVVFGCAGGGSNLAGLSFPFLREKVHGRSNPRIVAAEPS
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQRDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagctcgacgccacccatccggacctcgtcaccgtcgaggtgccgacgcac
tggtacaacctggcggccgagctgggcgagccgatcccgccgcatctgcatcccggcacc
aaagaaccggtcagcccggacgacctcgcgccgctgttcgccagcgggttgatcgcccag
gaggcatccaccgagacctacatcgagatcccgcaggcggtgcgggagatctacacgatg
tggcggccgtctccgctgatccgcgcacggcgcttcgagaaggccctgaacaccggcgcc
cacatctacgtcaagtacgaaggtgtcagcccggtcggcagccacaagaccaactccgcg
gtggcgcaggcgtactacaactccatcgacggcgtgcggaagctgaccaccgagaccggc
gccggccagtggggtagcgcgctgtcgttcgccggggtgcagttcggcttggagatcgag
gtgtggcaggtccgtgcctcgtatgagtccaagccgtatcgggggcatctgatgcggacc
tacggcggcacggtgcactcgagcccgtcgacgctcaccgaggcgggccgcgccatcctg
gcgaaggatccgcacaccaccggcagcctcggcatggctgtcagcgaggcggtcgaggtt
gccgcggccgacccggaggcccgctatgcgctgggcagcgtgctcaaccatgtggtcctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgttggtggagccgaacggc
gccgacgtcgtattcggttgcgccggaggcggttcgaacctcgccgggctgtcgttcccg
ttcctgcgggagaaggtccacggccggtcgaacccgcggatcgtggccgcagagccaagt
gcatgcccgtcgatcaccgagggtgagtaccgctacgaccatggcgacgtggccgggctg
accccgctgctcaagatgcacacgctgggaatggatttcgtgcccgacccgatccacgcc
ggcggactgcgctaccacgggatggcaccggcgctgagccacaccgtggagctgggtctg
gtcgagggcgtggcgatctcgcagcgcgacgcgttcgctgccggggtgcagttcgcgcga
acgcagggcatcgtgccggctccggagtcgacgcatgccatcgcggccgcagctgcacat
gtcgccgatgatccgcgcgagcaggtcgtggtgatcggactgtccgggcatggtcagctg
gatctgccggcctacgcggagtacctcgacggcaagctctga

DBGET integrated database retrieval system