KEGG   Mycobacterium sp. JLS: Mjls_2628Help
Entry
Mjls_2628         CDS       T00482                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mjl  Mycobacterium sp. JLS
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mjl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mjls_2628
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mjls_2628
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mjls_2628
Enzymes [BR:mjl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mjls_2628
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
Position
2750704..2752005
Genome map
AA seq 433 aa AA seqDB search
MTEQLDATHPDLVTVEVPTHWYNLAAELGEPIPPHLHPGTKEPVSPDDLAPLFASGLIAQ
EASTETYIEIPQAVREIYTMWRPSPLIRARRFEKALNTGAHIYVKYEGVSPVGSHKTNSA
VAQAYYNSIDGVRKLTTETGAGQWGSALSFAGVQFGLEIEVWQVRASYESKPYRGHLMRT
YGGTVHSSPSTLTEAGRAILAKDPHTTGSLGMAVSEAVEVAAADPEARYALGSVLNHVVL
HQTVIGQEAVAQLALVEPNGADVVFGCAGGGSNLAGLSFPFLREKVHGRSNPRIVAAEPS
ACPSITEGEYRYDHGDVAGLTPLLKMHTLGMDFVPDPIHAGGLRYHGMAPALSHTVELGL
VEGVAISQRDAFAAGVQFARTQGIVPAPESTHAIAAAAAHVADDPREQVVVIGLSGHGQL
DLPAYAEYLDGKL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagctcgacgccacccatccggacctcgtcaccgtcgaggtgccgacgcac
tggtacaacctggcggccgagctgggcgagccgatcccgccgcatctgcatcccggcacc
aaagaaccggtcagcccggacgacctcgcgccgctgttcgccagcgggttgatcgcccag
gaggcatccaccgagacctacatcgagatcccgcaggcggtgcgggagatctacacgatg
tggcggccgtctccgctgatccgcgcacggcgcttcgagaaggccctgaacaccggcgcc
cacatctacgtcaagtacgaaggtgtcagcccggtcggcagccacaagaccaactccgcg
gtggcgcaggcgtactacaactccatcgacggcgtgcggaagctgaccaccgagaccggc
gccggccagtggggtagcgcgctgtcgttcgccggggtgcagttcggcttggagatcgag
gtgtggcaggtccgtgcctcgtatgagtccaagccgtatcgggggcatctgatgcggacc
tacggcggcacggtgcactcgagcccgtcgacgctcaccgaggcgggccgcgccatcctg
gcgaaggatccgcacaccaccggcagcctcggcatggctgtcagcgaggcggtcgaggtt
gccgcggccgacccggaggcccgctatgcgctgggcagcgtgctcaaccatgtggtcctg
catcagaccgtcatcggccaggaggccgtcgcgcagctggcgttggtggagccgaacggc
gccgacgtcgtattcggttgcgccggaggcggttcgaacctcgccgggctgtcgttcccg
ttcctgcgggagaaggtccacggccggtcgaacccgcggatcgtggccgcagagccaagt
gcatgcccgtcgatcaccgagggtgagtaccgctacgaccatggcgacgtggccgggctg
accccgctgctcaagatgcacacgctgggaatggatttcgtgcccgacccgatccacgcc
ggcggactgcgctaccacgggatggcaccggcgctgagccacaccgtggagctgggtctg
gtcgagggcgtggcgatctcgcagcgcgacgcgttcgctgccggggtgcagttcgcgcga
acgcagggcatcgtgccggctccggagtcgacgcatgccatcgcggccgcagctgcacat
gtcgccgatgatccgcgcgagcaggtcgtggtgatcggactgtccgggcatggtcagctg
gatctgccggcctacgcggagtacctcgacggcaagctctga

DBGET integrated database retrieval system