KEGG   Mycobacterium sp. KMS: Mkms_2778Help
Entry
Mkms_2778         CDS       T00442                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
mkm  Mycobacterium sp. KMS
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Mkms_2778
Enzymes [BR:mkm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Mkms_2778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2897875..2898912
Genome map
AA seq 345 aa AA seqDB search
MGHAHDREPQRDVPPGMAEQLDLPHSGMATFGHRPFLTETAQLDSWRPDVAIVGAPFDVG
TTNRPGARFGPRAIRATAYEPGTYHMDLGLEIFDWLEVVDFGDAYCPHGQTEVSHANIRE
RVAAVASRGIVPVVLGGDHSITWPAATAVADVHGHGNVGIVHFDAHADTADTIEGNLASH
GTPMRRLIESGAVPGTHFVQVGLRGYWPPQDTFEWMLEQGMTWHTMQEIWERGFQEVMRD
AVAEALARADKLYVSVDIDVLDPAHAPGTGTPEPGGITSADLLRMVRRLCYEHDVAGVDV
VEVAPAYDHAELTVNAAHRVVFEALAGMAARRRDAAGAQPGPPAR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgggccatgcgcacgaccgcgagccgcaacgggatgtcccgccgggaatggccgaacaa
ctcgacctgccccattcggggatggccactttcggtcatcggccgttcctgaccgagacc
gcccaactggactcgtggcggcccgatgtcgcgatcgtcggtgcgccgttcgacgtgggg
accaccaaccgcccgggcgcgcggttcgggccgcgcgccatccgggcgacggcgtacgaa
cccggcacgtaccacatggatctggggctggagatcttcgactggctggaggtggtcgac
ttcggcgacgcctactgtccgcacgggcagaccgaggtgtcgcacgccaacatccgcgag
cgggtggccgcggtcgcgtcgcgcggcatcgtgccggtcgtcctcggtggtgaccactcg
atcacgtggccggcagccaccgcggtcgccgatgtgcacggccacggcaacgtcggcatc
gtgcacttcgacgcccacgccgacaccgccgacaccatcgagggcaacctggccagtcac
ggcacgccgatgcggcggctcatcgaatcgggtgcggtccccggaacccacttcgtacaa
gtcggtctgcgcggctactggccgccgcaggacaccttcgagtggatgctcgaacagggc
atgacctggcacaccatgcaggagatctgggagcgcggcttccaggaggtgatgcgcgac
gcggtggccgaggcgctcgccagggccgacaagctctacgtctccgtggacatcgacgtc
ctcgatcccgcccacgcccccggcaccgggaccccggaaccgggcggcatcaccagcgcg
gacctactccggatggtccggcggctctgttacgagcacgatgtggcgggtgtcgacgtc
gtcgaggtcgcaccggcctacgaccacgccgaactgaccgtcaacgccgcgcaccgggtg
gtgttcgaagcgctggccgggatggcggcccgcaggcgcgacgccgcgggcgcccagccc
ggtccgcccgcccggtga

DBGET integrated database retrieval system