KEGG   Mycoplasma leachii 99/014/6: MLEA_009200Help
Entry
MLEA_009200       CDS       T02144                                 

Definition
1-phosphofructokinase
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
mlh  Mycoplasma leachii 99/014/6
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:mlh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MLEA_009200
Enzymes [BR:mlh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     MLEA_009200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
996861..997796
Genome map
AA seq 311 aa AA seqDB search
MIYTITLNPAIDCVIETNEIDFNNTNYYTNSYSLIGGKGINVAIILNNLKNDVISTGFLG
KNNANQFLDKFLKLNLKNHFFLYNGITRTNFKIKNLNTFDEIELNGVGCDLKSSYLNKLL
KYLKDNLKENDIVIAIGSVNKSFNDNVYQIIGDLVNKKQALFILDTSKKYLLEGLKAKPF
LIKPNISELFSVFNEPISYEFDEICKKIKQLQNLGARNILLSMANKGSYYFSENNDIYKI
GVGQGKLVNSTGAGDSMLAGFVHGLNQQLDIIKTLKYAASCGSSTAFSKWLATKKEINKH
LKEIKVKKIER
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatttatacaattactttaaaccccgctattgattgtgtaattgaaactaatgaaata
gattttaataacactaattattatacaaatagttattcattaattggtggtaagggaatt
aatgtagcaattattttaaataatttaaaaaatgatgttataagtacaggttttttaggt
aaaaataatgccaatcaatttttagataaatttttaaaattgaatttaaaaaatcatttc
tttttatacaatggtataactagaactaattttaagattaaaaatttaaatacttttgat
gaaatagagctgaatggtgtcggttgtgatcttaaatcaagttatctaaataagttatta
aaatatcttaaagataatttaaaggaaaatgatattgttatagctattggaagtgttaat
aaatcatttaatgataatgtttatcaaattataggtgatcttgttaataaaaaacaagct
ttattcattttagatacctctaaaaaatatcttttagaaggtctaaaagcaaaacctttt
ttaattaaaccaaacattagtgaattattttcagtttttaatgaacctattagttatgaa
tttgatgaaatttgtaaaaaaataaagcaactacaaaatttaggtgctagaaatatttta
ttaagtatggcaaataaaggaagctattatttttcagaaaacaatgatatttataaaata
ggggttggtcaaggaaaactagttaattcaactggagctggtgattcaatgttagctgga
tttgttcacggattaaatcaacaattagatattataaaaactttaaaatatgctgctagc
tgcgggtcaagtactgcttttagtaaatgactagcaacaaaaaaagaaatcaataaacac
ttaaaagaaattaaagttaaaaaaatagaaaggtag

DBGET integrated database retrieval system