KEGG   Mesorhizobium loti: mll5495Help
Entry
mll5495           CDS       T00043                                 

Definition
cytochrome C
Orthology
K08738  
cytochrome c
Organism
mlo  Mesorhizobium loti
Pathway
Sulfur metabolism
Two-component system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:mlo00920]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mlo02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
complement(4409767..4410414)
Genome map
AA seq 215 aa AA seqDB search
MDSNEVNKLLAGLLGTVFVVFSVGLVSDALFASPAPEKPGFAIEAAEPAEGGPAAPAAES
KPIADLLQTANVEAGAAVFKKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGM
KEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSDNPKPL
PAPGAAADASAPAKPAAGAAPAKPADGAAPAAPAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacgaagtcaacaaactgctcgccggattgctcggaaccgtttttgtcgtt
ttctcggtcggcctggtatctgacgcgctgtttgcctcgccggctcctgaaaagcccggc
ttcgccatcgaggccgcggagccggccgaaggcggcccggccgcgccggccgccgaatcc
aagccgatcgccgatctgctgcagaccgccaatgtcgaggcgggtgccgccgtcttcaag
aaatgccaggcctgccattccggcgaaaagggtggccccaacaaggtcggccccgatctg
tgggatctcgtcgatcgtcctgtcgccgaacatgaaggcttcgcctattcggccggcatg
aaggagttttccaagggcggcaccgagaagtggacctatgacaacatcaaccacttcatc
acctcgccgaagaaattcgtgaagggcacggccatgggctttgccggcctgcccaaggac
gaggaccgtgccaacgtcatcgcctatctgcgcacgctgtcggacaatcccaagccgctg
ccggcaccaggcgccgccgccgacgccagcgcgcccgccaagcctgccgctggcgccgca
ccggccaagccggctgacggcgcggcaccagccgcgccggccaaataa

DBGET integrated database retrieval system