KEGG   Mesorhizobium japonicum MAFF 303099: mll5495Help
Entry
mll5495           CDS       T00043                                 

Definition
(GenBank) cytochrome c
  KO
K08738  cytochrome c
Organism
mlo  Mesorhizobium japonicum MAFF 303099
Pathway
mlo00920  Sulfur metabolism
mlo01100  Metabolic pathways
mlo01120  Microbial metabolism in diverse environments
mlo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    mll5495
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    mll5495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: BAB51938
RhizoBase: mll5495
UniProt: Q98BN4
Position
complement(4409767..4410414)
Genome map
AA seq 215 aa AA seqDB search
MDSNEVNKLLAGLLGTVFVVFSVGLVSDALFASPAPEKPGFAIEAAEPAEGGPAAPAAES
KPIADLLQTANVEAGAAVFKKCQACHSGEKGGPNKVGPDLWDLVDRPVAEHEGFAYSAGM
KEFSKGGTEKWTYDNINHFITSPKKFVKGTAMGFAGLPKDEDRANVIAYLRTLSDNPKPL
PAPGAAADASAPAKPAAGAAPAKPADGAAPAAPAK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atggattccaacgaagtcaacaaactgctcgccggattgctcggaaccgtttttgtcgtt
ttctcggtcggcctggtatctgacgcgctgtttgcctcgccggctcctgaaaagcccggc
ttcgccatcgaggccgcggagccggccgaaggcggcccggccgcgccggccgccgaatcc
aagccgatcgccgatctgctgcagaccgccaatgtcgaggcgggtgccgccgtcttcaag
aaatgccaggcctgccattccggcgaaaagggtggccccaacaaggtcggccccgatctg
tgggatctcgtcgatcgtcctgtcgccgaacatgaaggcttcgcctattcggccggcatg
aaggagttttccaagggcggcaccgagaagtggacctatgacaacatcaaccacttcatc
acctcgccgaagaaattcgtgaagggcacggccatgggctttgccggcctgcccaaggac
gaggaccgtgccaacgtcatcgcctatctgcgcacgctgtcggacaatcccaagccgctg
ccggcaccaggcgccgccgccgacgccagcgcgcccgccaagcctgccgctggcgccgca
ccggccaagccggctgacggcgcggcaccagccgcgccggccaaataa

DBGET integrated database retrieval system