KEGG   Mesorhizobium loti: mlr5709Help
Entry
mlr5709           CDS       T00043                                 

Definition
sugar isomerase
Organism
mlo  Mesorhizobium loti
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4597643..4598935
Genome map
AA seq 430 aa AA seqDB search
MSETIISAEVVEKNNAARKPDLERDYASLGERLDRRGIAIDAIRAKVEKFAVAIPSWGVG
TGGTRFARFPGAGEPRDIFDKIEDCAVISQLTQATPTVSLHIPWDKADPNRLKQAASRFG
LGFDAMNSNTFSDARDQKLSYKFGSLSHADAGTRRQAVEHNLECIEIGKTLGSKALTVWI
GDGSNFPGQVNFARAFERYLDAMKAVYAGLPADWKLFTEHKMYEPAFYSTVVQDWGTNYL
IAKELGDRAFCLVDLGHHAPNVNIEMIVSRLIQFKKLGGFHFNDSKYGDDDLDAGSIDPY
RLFLVFNELVDAELSGAEGFDPAHMLDQSHNVTDPIESLMLSAVEVQRAYAQALLVDRKA
LEGFQDGNDALMATQTLKAAYRTDVEPILAMARLKTGGAIDPVATYRAAGYRAKVAAERP
AVTGGSGGIV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaaaccatcatttccgccgaagtcgtcgaaaaaaataacgccgcccgcaagccc
gacctcgagcgcgactacgcctcgctcggcgagcgtctcgaccgtcgcggcattgccatc
gacgccatccgcgccaaggtcgagaaatttgcggtcgccatcccctcctggggcgtcggc
accggcggcacgcgctttgcccgctttcccggcgccggcgagccgcgcgatattttcgac
aagatcgaggattgcgccgtcatcagtcagctgacgcaggcgacaccgaccgtctcgttg
cacattccgtgggacaaggccgacccgaaccggctgaagcaggcggcctcgcgcttcggc
ctcggcttcgacgcgatgaattccaacaccttctccgatgcccgcgaccagaaactctcc
tacaaattcggctcgctgtcgcatgccgatgccggcacccgccggcaggcggtcgagcac
aatctcgaatgcatcgagatcggcaagacgctcggctccaaggcgctgacggtgtggatc
ggcgacggctcgaattttcccggccaagtcaatttcgccagagcgttcgagcgctacctc
gacgccatgaaggcggtttatgccgggctgcccgccgactggaaactgttcaccgaacac
aagatgtacgagccggccttctattccacggtcgtgcaggactggggtaccaactacctt
atcgccaaggaattgggcgacagggctttctgcctcgtcgatctcggccaccatgcgccg
aacgtcaacatcgagatgatcgtgtcgcggctgatccagttcaagaaactcggcggcttc
cacttcaacgattcgaaatatggcgacgacgatctcgacgccggttcgatcgatccttac
cggctgttcctggtcttcaacgaactggtcgatgccgaactgtccggcgccgaaggtttc
gatcccgcccacatgctcgaccagagccacaacgtcaccgatccgatcgaaagcctgatg
ctgtcggcggtcgaggtgcagcgcgcctatgcgcaggcgctgctggtcgaccgcaaggcg
ctcgaaggttttcaggacggcaatgacgcgctgatggcgacgcagacgctgaaggcggcc
taccgcaccgatgtcgagccgatcctggccatggcgcggctgaaaaccgggggcgccatc
gatccggtcgccacctaccgggcggcgggctaccgcgccaaggtcgcggccgaacgcccg
gctgtcaccggcggcagcggcgggattgtctga

  All links  
No link information was found.   
DBGET integrated database retrieval system