KEGG   Mesorhizobium loti: mlr5709Help
Entry
mlr5709           CDS       T00043                                 

Definition
sugar isomerase
Orthology
K01820  
L-rhamnose isomerase / sugar isomerase [EC:5.3.1.14 5.3.1.-]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    mlr5709
   00051 Fructose and mannose metabolism
    mlr5709
Enzymes [BR:mlo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.14  L-rhamnose isomerase
     mlr5709
    5.3.1.-  
     mlr5709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
4597643..4598935
Genome map
AA seq 430 aa AA seqDB search
MSETIISAEVVEKNNAARKPDLERDYASLGERLDRRGIAIDAIRAKVEKFAVAIPSWGVG
TGGTRFARFPGAGEPRDIFDKIEDCAVISQLTQATPTVSLHIPWDKADPNRLKQAASRFG
LGFDAMNSNTFSDARDQKLSYKFGSLSHADAGTRRQAVEHNLECIEIGKTLGSKALTVWI
GDGSNFPGQVNFARAFERYLDAMKAVYAGLPADWKLFTEHKMYEPAFYSTVVQDWGTNYL
IAKELGDRAFCLVDLGHHAPNVNIEMIVSRLIQFKKLGGFHFNDSKYGDDDLDAGSIDPY
RLFLVFNELVDAELSGAEGFDPAHMLDQSHNVTDPIESLMLSAVEVQRAYAQALLVDRKA
LEGFQDGNDALMATQTLKAAYRTDVEPILAMARLKTGGAIDPVATYRAAGYRAKVAAERP
AVTGGSGGIV
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgaaaccatcatttccgccgaagtcgtcgaaaaaaataacgccgcccgcaagccc
gacctcgagcgcgactacgcctcgctcggcgagcgtctcgaccgtcgcggcattgccatc
gacgccatccgcgccaaggtcgagaaatttgcggtcgccatcccctcctggggcgtcggc
accggcggcacgcgctttgcccgctttcccggcgccggcgagccgcgcgatattttcgac
aagatcgaggattgcgccgtcatcagtcagctgacgcaggcgacaccgaccgtctcgttg
cacattccgtgggacaaggccgacccgaaccggctgaagcaggcggcctcgcgcttcggc
ctcggcttcgacgcgatgaattccaacaccttctccgatgcccgcgaccagaaactctcc
tacaaattcggctcgctgtcgcatgccgatgccggcacccgccggcaggcggtcgagcac
aatctcgaatgcatcgagatcggcaagacgctcggctccaaggcgctgacggtgtggatc
ggcgacggctcgaattttcccggccaagtcaatttcgccagagcgttcgagcgctacctc
gacgccatgaaggcggtttatgccgggctgcccgccgactggaaactgttcaccgaacac
aagatgtacgagccggccttctattccacggtcgtgcaggactggggtaccaactacctt
atcgccaaggaattgggcgacagggctttctgcctcgtcgatctcggccaccatgcgccg
aacgtcaacatcgagatgatcgtgtcgcggctgatccagttcaagaaactcggcggcttc
cacttcaacgattcgaaatatggcgacgacgatctcgacgccggttcgatcgatccttac
cggctgttcctggtcttcaacgaactggtcgatgccgaactgtccggcgccgaaggtttc
gatcccgcccacatgctcgaccagagccacaacgtcaccgatccgatcgaaagcctgatg
ctgtcggcggtcgaggtgcagcgcgcctatgcgcaggcgctgctggtcgaccgcaaggcg
ctcgaaggttttcaggacggcaatgacgcgctgatggcgacgcagacgctgaaggcggcc
taccgcaccgatgtcgagccgatcctggccatggcgcggctgaaaaccgggggcgccatc
gatccggtcgccacctaccgggcggcgggctaccgcgccaaggtcgcggccgaacgcccg
gctgtcaccggcggcagcggcgggattgtctga

DBGET integrated database retrieval system