KEGG   Mesorhizobium loti: mlr8492Help
Entry
mlr8492           CDS       T00043                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mlo  Mesorhizobium loti
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mlo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    mlr8492
Enzymes [BR:mlo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     mlr8492
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RhizoBase: 
UniProt: 
Position
6973163..6974092
Genome map
AA seq 309 aa AA seqDB search
MAAGKPVVILGVFVADTAYRADRQPRMGETILGNSFKLGPGGKGSNQAVAAGKLGADTTF
LTRLGVDAFADMAKRTWQDAGVKSAVIDTPDSYTGAAYIFVEEGSGNNAIIVSPGAAMLI
SPTDIEANAALIRGAGVFVTQLEQPIDAAMRALEIARGAGVTTILNPAPAAKLPDRVYTL
CDYLTPNETETEELTGLKVSSVDEARTASGKLLEKGVGTVIVTLGDKGALLHSKGRSEHV
PAISAGPVVETTGAGDAFNGGFAAALSRGVEPLQAVRFACAVAGISVTRPGTAPSMPTLQ
EVEALLAKG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcagccggaaagcctgtcgtcatattgggcgtcttcgtcgccgataccgcctatcgc
gccgatcgccagccgcgcatgggcgagacgatcctcggcaattcgttcaagctgggcccg
ggtggcaaggggtcgaaccaggccgtggccgccggcaagctcggcgccgacaccactttc
ctgacccgccttggagtcgatgcgttcgccgacatggccaagcggacatggcaggatgcc
ggcgtgaaaagcgccgtcatcgacacgccggacagctatacgggcgccgcctacatcttc
gtcgaggagggcagcggcaacaacgccatcatcgtcagcccgggtgcggccatgctgatc
tcgccgaccgatatcgaggccaatgccgccctgattcgtggtgccggcgtcttcgtaacc
cagctcgaacagccgatcgatgctgcgatgcgggcgctggagatcgcgcgcggggcaggg
gtgacgaccatcctcaaccctgcccccgcggcaaagctgcccgaccgcgtctacacgctc
tgcgactatctcacgccaaacgagaccgagacggaggaattgaccggactgaaggtctct
tcggtcgatgaggcgcgcaccgcctccggcaagctgctcgaaaagggcgtcggcaccgtc
atcgtcacactcggcgacaagggcgcgctgctgcactcgaagggacgctccgagcatgtc
cccgctatcagcgcggggccggtggttgaaaccactggcgcgggcgacgccttcaacggc
ggcttcgcggcagccctatcgcgaggcgtggagccgctgcaggcggtgcgcttcgcatgc
gccgtcgccggcatttcggtgacgcgacccggcaccgcgccgtcgatgccgacgctgcaa
gaggtcgaggcactgctggcgaagggttga

DBGET integrated database retrieval system